5W45: APOBEC3H

Crystal structure of APOBEC3H. Determined by X-ray diffraction at 2.49 Å resolution. Released 14 Mar 2018.

Method: X-ray diffraction
Resolution: 2.49 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,009
Mol. weight: 42.53 kDa
Ligands: ZN
Released: 14 Mar 2018

Explore 5W45 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W45 contains 20 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
α-helix	6-13	8
α-helix	21-23	3
β-strand	29-36	8	2
α-helix	40-42	3
β-strand	43-48	6	2
α-helix	55-66	12
β-strand	74-82	9	2
α-helix	86-98	13
β-strand	102-110	9	2
α-helix	117-129	13
β-strand	133-135	3	2
α-helix	136	1
α-helix	138-148	11
β-strand	149	1	1
α-helix	154-155	2
α-helix	159-180	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
APOBEC3H	A, B	protein	181	Homo sapiens	Q6NTF7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5W45_1 APOBEC3H (chains A, B)
ALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAAICFIN
EIKSMGLDETQCYQVTCYLTWSPCSSCASELVDFIKAHDHLNLRIFASRLYYHASKPQQD
GLRLLSQEGVPVEVMGFPEFADCWENFVDHEKPASFNPYKMLEELDKNSRAIKRRLDRIK
S

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Understanding the Structure, Multimerization, Subcellular Localization and mC Selectivity of a Genomic Mutator and Anti-HIV Factor APOBEC3H. Ito, F., Yang, H., Xiao, X. et al. Sci Rep (2018) 8:3763-3763. DOI 10.1038/s41598-018-21955-0 · PubMed

Other PDB entries of the same protein (UniProt Q6NTF7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FVI 3.24 Å, Human APOBEC3H bound to HIV-1 Vif in complex with CBF-beta, ELOB, ELOC, and CUL5
6B0B 3.28 Å, Crystal structure of human APOBEC3H
6BBO 3.43 Å, Crystal structure of human APOBEC3H/RNA complex

Browse structure collections

About this viewer

MolViewer shows 5W45 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.