Crystal Complex of Cyclooxygenase-2: (S)-ARN-2508 (a dual COX and FAAH inhibitor). Determined by X-ray diffraction at 2.27 Å resolution. Released 31 Jan 2018.
Explore 5W58 in 3D Show helices and sheets RCSB PDB PDBe
5W58 contains 47 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46-49 | 4 | 1 |
| β-strand | 55-58 | 4 | 1 |
| β-strand | 64-65 | 2 | 2 |
| β-strand | 71-72 | 2 | 2 |
| α-helix | 74-82 | 9 | |
| α-helix | 83-85 | 3 | |
| α-helix | 86-93 | 8 | |
| α-helix | 97-104 | 8 | |
| α-helix | 106-121 | 16 | |
| β-strand | 130-131 | 2 | 3 |
| β-strand | 134 | 1 | 3 |
| α-helix | 139-143 | 5 | |
| β-strand | 147 | 1 | 4 |
| β-strand | 149-150 | 2 | 3 |
| α-helix | 153-156 | 4 | |
| β-strand | 161 | 1 | 5 |
| β-strand | 164 | 1 | 5 |
| α-helix | 171-173 | 3 | |
| α-helix | 174-177 | 4 | |
| α-helix | 178-182 | 5 | |
| β-strand | 183 | 1 | 6 |
| β-strand | 189 | 1 | 7 |
| β-strand | 194 | 1 | 8 |
| β-strand | 195 | 1 | 9 |
| α-helix | 196-206 | 11 | |
| β-strand | 212 | 1 | 10 |
| β-strand | 220 | 1 | 4 |
| β-strand | 221 | 1 | 10 |
| α-helix | 231-234 | 4 | |
| α-helix | 238-244 | 7 | |
| β-strand | 245 | 1 | 11 |
| α-helix | 251 | 1 | |
| β-strand | 252 | 1 | 11 |
| α-helix | 253 | 1 | |
| β-strand | 255-257 | 3 | 12 |
| β-strand | 260-262 | 3 | 12 |
| α-helix | 263-264 | 2 | |
| β-strand | 265 | 1 | 13 |
| α-helix | 266-269 | 4 | |
| α-helix | 281-283 | 3 | |
| β-strand | 285 | 1 | 13 |
| α-helix | 292-294 | 3 | |
| α-helix | 296-319 | 24 | |
| α-helix | 325-343 | 19 | |
| α-helix | 344-349 | 6 | |
| α-helix | 350-353 | 4 | |
| α-helix | 363-366 | 4 | |
| β-strand | 378 | 1 | 3 |
| α-helix | 379-384 | 6 | |
| α-helix | 388-390 | 3 | |
| β-strand | 395-397 | 3 | 14 |
| β-strand | 400-402 | 3 | 14 |
| α-helix | 404-407 | 4 | |
| α-helix | 411-428 | 18 | |
| β-strand | 430 | 1 | 9 |
| α-helix | 431 | 1 | |
| β-strand | 432 | 1 | 7 |
| α-helix | 433 | 1 | |
| β-strand | 440 | 1 | 6 |
| α-helix | 442-444 | 3 | |
| α-helix | 445-457 | 13 | |
| α-helix | 460-462 | 3 | |
| α-helix | 463-469 | 7 | |
| α-helix | 473-475 | 3 | |
| α-helix | 478-482 | 5 | |
| α-helix | 486-495 | 10 | |
| α-helix | 498-500 | 3 | |
| α-helix | 503-509 | 7 | |
| α-helix | 511 | 1 | |
| β-strand | 512 | 1 | 15 |
| α-helix | 513 | 1 | |
| β-strand | 519 | 1 | 15 |
| α-helix | 520-535 | 16 | |
| α-helix | 538-540 | 3 | |
| α-helix | 547-550 | 4 | |
| α-helix | 553-560 | 8 | |
| α-helix | 564-571 | 8 | |
| β-strand | 581 | 1 | 8 |
| α-helix | 585-587 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Prostaglandin G/H synthase 2 | A | protein | 587 | Mus musculus | Q05769 (AlphaFold model) |
>5W58_1 Prostaglandin G/H synthase 2 (chains A) ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYI LTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRA LPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFK TDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQT SRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLL PDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKAS IDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNN VKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL
| ID | Name | Formula | Copies |
|---|---|---|---|
| FF8 | (2S)-2-{2-fluoro-3'-[(hexylcarbamoyl)oxy][1,1'-biphenyl]-4-yl}propanoic acid | C22 H26 F N O4 | 1 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
| BOG | octyl beta-D-glucopyranoside | C14 H28 O6 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Dual cyclooxygenase-fatty acid amide hydrolase inhibitor exploits novel binding interactions in the cyclooxygenase active site. Goodman, M.C., Xu, S., Rouzer, C.A. et al. J Biol Chem (2018) 293:3028-3038. DOI 10.1074/jbc.M117.802058 · PubMed
Other PDB entries of the same protein (UniProt Q05769 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5W58 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.