Crystal structure of human IgG1-Sigma Fc fragment. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Sept 2017.
Explore 5W5L in 3D Show helices and sheets RCSB PDB PDBe
5W5L contains 22 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 240-243 | 4 | 1 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 1 |
| β-strand | 274-279 | 6 | 2 |
| β-strand | 282-284 | 3 | 2 |
| β-strand | 288-289 | 2 | 1 |
| α-helix | 290-292 | 3 | |
| β-strand | 293-294 | 2 | 1 |
| β-strand | 300-307 | 8 | 1 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 2 |
| β-strand | 332-336 | 5 | 2 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 3 |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378-383 | 6 | 5 |
| β-strand | 386-387 | 2 | 5 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 4 |
| β-strand | 404-413 | 10 | 4 |
| α-helix | 414-418 | 5 | |
| β-strand | 423-428 | 6 | 5 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 237-239 | 3 | |
| β-strand | 240-243 | 4 | 6 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 6 |
| β-strand | 274-279 | 6 | 7 |
| β-strand | 282-284 | 3 | 7 |
| β-strand | 288-289 | 2 | 6 |
| α-helix | 290-292 | 3 | |
| β-strand | 293-294 | 2 | 6 |
| β-strand | 300-307 | 8 | 6 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 7 |
| β-strand | 332-336 | 5 | 7 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 8 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 9 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 9 |
| β-strand | 373 | 1 | 8 |
| β-strand | 378-383 | 6 | 10 |
| β-strand | 386-387 | 2 | 10 |
| β-strand | 391-393 | 3 | 9 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 9 |
| β-strand | 404-413 | 10 | 9 |
| α-helix | 414-418 | 5 | |
| β-strand | 423-428 | 6 | 10 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin gamma-1 heavy chain | A, B | protein | 223 | Homo sapiens | P0DOX5 (AlphaFold model) |
>5W5L_1 Immunoglobulin gamma-1 heavy chain (chains A, B) TCPPCPAPEAAGASSVFLFPPKPKDTLMISRTPEVTCVVVDVSAEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Functional, Biophysical, and Structural Characterization of Human IgG1 and IgG4 Fc Variants with Ablated Immune Functionality. Tam, S.H., McCarthy, S.G., Armstrong, A.A. et al. Antibodies (Basel) (2017) 6. DOI 10.3390/antib6030012 · PubMed
Other PDB entries of the same protein (UniProt P0DOX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5W5L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.