UCA Fab (unbound) from 6649 Lineage. Determined by X-ray diffraction at 1.63 Å resolution. Released 13 Dec 2017.
Explore 5W6C in 3D Show helices and sheets RCSB PDB PDBe
5W6C contains 19 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 34-41 | 8 | 3 |
| β-strand | 48-54 | 7 | 3 |
| β-strand | 59-61 | 3 | 3 |
| α-helix | 66-68 | 3 | |
| β-strand | 69-74 | 6 | 1 |
| α-helix | 75-77 | 3 | |
| β-strand | 79-84 | 6 | 1 |
| α-helix | 89-91 | 3 | |
| β-strand | 93-101 | 9 | 3 |
| α-helix | 105-107 | 3 | |
| β-strand | 115 | 1 | 3 |
| β-strand | 119-121 | 3 | 3 |
| β-strand | 122-123 | 2 | 2 |
| α-helix | 127-128 | 2 | |
| β-strand | 129 | 1 | 4 |
| α-helix | 130-131 | 2 | |
| β-strand | 132-139 | 8 | 5 |
| β-strand | 147-157 | 11 | 5 |
| β-strand | 158 | 1 | 4 |
| β-strand | 163-166 | 4 | 6 |
| α-helix | 167-169 | 3 | |
| β-strand | 171 | 1 | 6 |
| β-strand | 175-177 | 3 | 5 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-182 | 2 | 5 |
| β-strand | 188-197 | 10 | 5 |
| α-helix | 198-200 | 3 | |
| β-strand | 207-212 | 6 | 6 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 7 |
| β-strand | 5 | 1 | 8 |
| β-strand | 9-12 | 4 | 9 |
| β-strand | 18-23 | 6 | 8 |
| α-helix | 29-31 | 3 | |
| β-strand | 36-40 | 5 | 9 |
| β-strand | 47-50 | 4 | 9 |
| β-strand | 51 | 1 | 10 |
| β-strand | 55 | 1 | 10 |
| α-helix | 56-57 | 2 | |
| β-strand | 64-69 | 6 | 8 |
| β-strand | 72-77 | 6 | 8 |
| α-helix | 82-84 | 3 | |
| β-strand | 86-94 | 9 | 9 |
| β-strand | 100-103 | 4 | 9 |
| β-strand | 104 | 1 | 7 |
| β-strand | 107-111 | 5 | 9 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 11 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 12 |
| α-helix | 125-127 | 3 | |
| α-helix | 128-132 | 5 | |
| β-strand | 136-145 | 10 | 12 |
| β-strand | 146 | 1 | 11 |
| β-strand | 151-156 | 6 | 13 |
| β-strand | 159-161 | 3 | 13 |
| β-strand | 165-167 | 3 | 12 |
| α-helix | 168-170 | 3 | |
| β-strand | 171-172 | 2 | 12 |
| β-strand | 178-186 | 9 | 12 |
| α-helix | 188-193 | 6 | |
| β-strand | 197-203 | 7 | 13 |
| β-strand | 206-212 | 7 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| UCA Fab heavy chain | H | protein | 236 | Homo sapiens | S6B2B6 (AlphaFold model) |
| UCA Fab light chain | L | protein | 218 | Homo sapiens | Q6GMX4 (AlphaFold model) |
>5W6C_1 UCA Fab heavy chain (chains H) QLQLQESGPGLVKPSETLSLTCTVSGGSISSSSYYWGWIRQPPGKGLEWIGSIYYSGSTY YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCATSYVDNWHSGLHWFDPWGQGTL VTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH
>5W6C_2 UCA Fab light chain (chains L) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGV PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGDMVFGGGTKLTVLGQPKGAPS VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA SSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Conserved epitope on influenza-virus hemagglutinin head defined by a vaccine-induced antibody. Raymond, D.D., Bajic, G., Ferdman, J. et al. Proc Natl Acad Sci U S A (2018) 115:168-173. DOI 10.1073/pnas.1715471115 · PubMed
Other PDB entries of the same protein (UniProt S6B2B6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5W6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.