Crystal structure of MERS-CoV papain-like protease in complex with the C-terminal domain of human ISG15. Determined by X-ray diffraction at 2.41 Å resolution. Released 27 Sept 2017.
Explore 5W8U in 3D Show helices and sheets RCSB PDB PDBe
5W8U contains 31 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| β-strand | 16-21 | 6 | 1 |
| α-helix | 26-29 | 4 | |
| β-strand | 33-35 | 3 | 1 |
| β-strand | 38-39 | 2 | 1 |
| α-helix | 44-45 | 2 | |
| α-helix | 47-49 | 3 | |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 62-72 | 11 | |
| α-helix | 79-89 | 11 | |
| β-strand | 95-98 | 4 | 2 |
| β-strand | 101-104 | 4 | 2 |
| α-helix | 111-120 | 10 | |
| β-strand | 126-128 | 3 | 3 |
| α-helix | 131-142 | 12 | |
| α-helix | 146-155 | 10 | |
| α-helix | 158-159 | 2 | |
| α-helix | 166-174 | 9 | |
| β-strand | 177-179 | 3 | 3 |
| β-strand | 184-191 | 8 | 4 |
| β-strand | 195-202 | 8 | 4 |
| α-helix | 203-206 | 4 | |
| β-strand | 208-210 | 3 | 5 |
| α-helix | 215-219 | 5 | |
| β-strand | 222-225 | 4 | 4 |
| β-strand | 231-241 | 11 | 4 |
| β-strand | 244-256 | 13 | 5 |
| β-strand | 265-270 | 6 | 5 |
| β-strand | 278-285 | 8 | 5 |
| β-strand | 288-293 | 6 | 5 |
| β-strand | 296-300 | 5 | 5 |
| β-strand | 302-312 | 11 | 5 |
| β-strand | 315-318 | 4 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 82-87 | 6 | 6 |
| β-strand | 93-98 | 6 | 6 |
| β-strand | 103 | 1 | 7 |
| α-helix | 104-115 | 12 | |
| α-helix | 119-121 | 3 | |
| β-strand | 122-126 | 5 | 6 |
| β-strand | 129-130 | 2 | 6 |
| β-strand | 136 | 1 | 7 |
| α-helix | 137-140 | 4 | |
| β-strand | 147-152 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 8 |
| β-strand | 15-21 | 7 | 8 |
| α-helix | 26-29 | 4 | |
| β-strand | 33-35 | 3 | 8 |
| β-strand | 38-39 | 2 | 8 |
| α-helix | 44-45 | 2 | |
| β-strand | 53-56 | 4 | 8 |
| α-helix | 62-72 | 11 | |
| α-helix | 79-89 | 11 | |
| β-strand | 95-98 | 4 | 9 |
| β-strand | 101-104 | 4 | 9 |
| α-helix | 105-106 | 2 | |
| α-helix | 111-120 | 10 | |
| β-strand | 126-128 | 3 | 10 |
| α-helix | 131-141 | 11 | |
| α-helix | 146-155 | 10 | |
| α-helix | 158-159 | 2 | |
| α-helix | 166-174 | 9 | |
| β-strand | 177-179 | 3 | 10 |
| β-strand | 184-191 | 8 | 11 |
| β-strand | 195-202 | 8 | 11 |
| α-helix | 203-206 | 4 | |
| β-strand | 208-210 | 3 | 12 |
| α-helix | 215-219 | 5 | |
| β-strand | 222-225 | 4 | 11 |
| β-strand | 231-241 | 11 | 11 |
| β-strand | 244-256 | 13 | 12 |
| β-strand | 265-270 | 6 | 12 |
| β-strand | 278-285 | 8 | 12 |
| β-strand | 288-293 | 6 | 12 |
| β-strand | 296-300 | 5 | 12 |
| β-strand | 302-312 | 11 | 12 |
| β-strand | 315-318 | 4 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 82-87 | 6 | 13 |
| β-strand | 93-98 | 6 | 13 |
| β-strand | 103 | 1 | 14 |
| α-helix | 104-115 | 12 | |
| α-helix | 119-121 | 3 | |
| β-strand | 122-126 | 5 | 13 |
| β-strand | 129-130 | 2 | 13 |
| α-helix | 131-132 | 2 | |
| β-strand | 136 | 1 | 14 |
| α-helix | 137-140 | 4 | |
| β-strand | 147-152 | 6 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ORF1ab | A, C | protein | 322 | Human betacoronavirus 2c EMC/2012 | M4STU1 |
| Ubiquitin-like protein ISG15 | B, D | protein | 78 | Homo sapiens | P05161 (AlphaFold model) |
>5W8U_1 ORF1ab (chains A, C) QLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNL TADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTL DLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELC CSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHT TPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKT SDWKCKVTDVLFPGQKYSSDCN
>5W8U_2 Ubiquitin-like protein ISG15 (chains B, D) MEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLG EYGLKPLSTVFMNLRLRG
Water and common crystallization additives (MPD) are not listed.
Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Daczkowski, C.M., Goodwin, O.Y., Dzimianski, J.V. et al. J Virol (2017) 91. DOI 10.1128/JVI.01067-17 · PubMed
Other PDB entries of the same protein (UniProt M4STU1), best resolution first:
MolViewer shows 5W8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.