5WB1: Envelope protein US28, nanobody 7 fusion protein

Ligand-free US28 with stabilizing intracellular nanobody. Determined by X-ray diffraction at 3.51 Å resolution. Released 13 Jun 2018.

Method: X-ray diffraction
Resolution: 3.51 Å
Organisms: Human cytomegalovirus, Lama glama
Chains: 1
Atoms: 3,291
Mol. weight: 51.83 kDa
Released: 13 Jun 2018

Explore 5WB1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WB1 contains 16 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	26-59	34
α-helix	67-83	17
α-helix	86-94	9
α-helix	101-133	33
α-helix	141-157	17
α-helix	160-163	4
α-helix	184-193	10
α-helix	194-198	5
α-helix	199-215	17
α-helix	223-255	33
α-helix	263-281	19
α-helix	283-287	5
α-helix	288-292	5
α-helix	296-310	15
α-helix	312-314	3
β-strand	1004-1007	4	1
β-strand	1010-1011	2	2
β-strand	1017-1024	8	1
β-strand	1031-1039	9	2
β-strand	1046-1052	7	2
β-strand	1057-1059	3	2
β-strand	1064	1	1
β-strand	1067-1072	6	1
β-strand	1077-1083	7	1
α-helix	1087-1089	3
β-strand	1091-1099	9	2
β-strand	1107-1108	2	2
β-strand	1109	1	1
β-strand	1112-1115	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope protein US28, nanobody 7 fusion protein	A	protein	458	Human cytomegalovirus, Lama glama	P69333

Sequence of entity 1 (A), FASTA

>5WB1_1 Envelope protein US28, nanobody 7 fusion protein (chains A)
DYKDDDDAMTPTTTTAELTTEFDYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNF
LVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFY
VAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFMVVTKKDNQ
CMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVSQSRHKGRIVRVLIA
VVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILTESLAFCHCCLNPLLYV
FVGTKFRQELHCLLAEFRLVPRGSGGSGGSLVPRGSQVQLVESGGGLVRPGGSLRLSCAA
SGSIFTIYAMGWYRQAPGKQRELVARITFGGDTNYADSVKGRFTISRDNAKNAVYLQMNS
LKPEDTAVYYCNAEETIVEEADYWGQGTQVTVSSRLEV

Primary citation

Viral GPCR US28 can signal in response to chemokine agonists of nearly unlimited structural degeneracy. Miles, T.F., Spiess, K., Jude, K.M. et al. Elife (2018) 7. DOI 10.7554/eLife.35850 · PubMed

Other PDB entries of the same protein (UniProt P69333), best resolution first:

5WB2 3.5 Å, US28 bound to engineered chemokine CX3CL1.35 and nanobodies

Browse structure collections

About this viewer

MolViewer shows 5WB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.