Solution NMR structure of PaurTx-3. Determined by solution NMR. Released 13 Sept 2017.
Explore 5WE3 in 3D Show helices and sheets RCSB PDB PDBe
5WE3 contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 1 |
| β-strand | 7-8 | 2 | 2 |
| α-helix | 9 | 1 | |
| β-strand | 16 | 1 | 1 |
| β-strand | 21-23 | 3 | 2 |
| β-strand | 29-32 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-theraphotoxin-Ps1a | A | protein | 34 | Paraphysa scrofa | P84510 (AlphaFold model) |
>5WE3_1 Beta-theraphotoxin-Ps1a (chains A) DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI
Lengths of the C-Terminus and Interconnecting Loops Impact Stability of Spider-Derived Gating Modifier Toxins. Agwa, A.J., Huang, Y.H., Craik, D.J. et al. Toxins (Basel) (2017) 9. DOI 10.3390/toxins9080248 · PubMed
Other PDB entries of the same protein (UniProt P84510 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WE3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.