5WHJ: Fab fragment of anti-FcRn antibody DX-2507

Crystal structure of Fab fragment of anti-FcRn antibody DX-2507. Determined by X-ray diffraction at 2.15 Å resolution. Released 6 Sept 2017.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,353
Mol. weight: 45.64 kDa
Released: 6 Sept 2017

Explore 5WHJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WHJ contains 20 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-39	7	3
β-strand	45-51	7	3
β-strand	59-60	2	3
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	3
β-strand	106	1	3
β-strand	110-112	3	3
β-strand	113-114	2	2
α-helix	118-119	2
β-strand	120	1	4
α-helix	121-122	2
β-strand	123-127	5	5
β-strand	138-148	11	5
β-strand	149	1	4
β-strand	154-157	4	6
α-helix	158-160	3
β-strand	162	1	6
β-strand	166-168	3	5
α-helix	169-171	3
β-strand	172-173	2	5
β-strand	179-188	10	5
α-helix	189-193	5
β-strand	198-203	6	6
α-helix	204-206	3
β-strand	208-213	6	6

Chain L: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	3	1
β-strand	4	1	7
β-strand	5	1	8
β-strand	9-12	4	9
β-strand	18-23	6	8
α-helix	29-31	3
β-strand	36-40	5	9
β-strand	47-50	4	9
β-strand	51	1	10
β-strand	55	1	10
α-helix	56-57	2
β-strand	64-69	6	8
β-strand	72-77	6	8
α-helix	82-84	3
β-strand	86-93	8	9
β-strand	99-101	3	9
β-strand	102	1	7
β-strand	105-109	5	9
α-helix	112-114	3
β-strand	115	1	11
α-helix	116-117	2
β-strand	118-122	5	12
α-helix	123-125	3
α-helix	126-130	5
β-strand	134-143	10	12
β-strand	144	1	11
β-strand	149-154	6	13
β-strand	157-159	3	13
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-170	2	12
β-strand	176-184	9	12
α-helix	186-190	5
β-strand	195-201	7	13
β-strand	204-210	7	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DX-2507 Fab heavy chain	H	protein	219	Homo sapiens	S6BAN1 (AlphaFold model)
DX-2507 Fab light chain	L	protein	216	Homo sapiens	Q6NS95 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>5WHJ_1 DX-2507 Fab heavy chain (chains H)
EVQLLESGGGLVQPGGSLRLSCAASGFTFSEYAMGWVRQAPGKGLEWVSSIGSSGGQTKY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARLAIGDSYWGQGTMVTVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Sequence of entity 2 (L), FASTA

>5WHJ_2 DX-2507 Fab light chain (chains L)
QSALTQPASVSGSPGQSITISCTGTGSDVGSYNLVSWYQQHPGKAPKLMIYGDSQRPSGV
SNRFSGSKSGNTASLTISGLQAEDEADYYCASYAGSGIYVFGTGTKVTVLGQPKANPTVT
LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASS
YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Structural basis for pH-insensitive inhibition of immunoglobulin G recycling by an anti-neonatal Fc receptor antibody. Kenniston, J.A., Taylor, B.M., Conley, G.P. et al. J Biol Chem (2017) 292:17449-17460. DOI 10.1074/jbc.M117.807396 · PubMed

Other PDB entries of the same protein (UniProt S6BAN1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WHK 2.5 Å, Crystal structure of Fab fragment of antibody DX-2507 bound to FcRn-B2M

Browse structure collections

About this viewer

MolViewer shows 5WHJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.