5WIW: PDB entry 5WIW

Crystal structure of murine 4-1BB N128A mutant from HEK293T cells in P43 space group. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,793
Mol. weight: 32.79 kDa
Ligands: NAG
Released: 20 Dec 2017

Explore 5WIW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WIW contains 11 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	63-65	3
β-strand	71-75	5	1
β-strand	84-87	4	1
α-helix	88	1
β-strand	91-94	4	2
β-strand	100-103	4	2
α-helix	104-106	3
β-strand	109-112	4	3
β-strand	115-118	4	3
α-helix	119-120	2
β-strand	123-124	2	4
β-strand	134-135	2	4
α-helix	136-137	2
β-strand	144-148	5	5
β-strand	157-161	5	5

Chain B: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	64-65	2
β-strand	71-75	5	6
β-strand	84-87	4	6
α-helix	88	1
β-strand	91-94	4	7
β-strand	100-103	4	7
α-helix	104-106	3
β-strand	109-112	4	8
β-strand	115-118	4	8
α-helix	119-120	2
β-strand	123-124	2	9
β-strand	134-135	2	9
α-helix	136-137	2
α-helix	140-142	3
β-strand	146-148	3	10
β-strand	157-158	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 9	A, B	protein	143	Mus musculus	P20334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WIW_1 Tumor necrosis factor receptor superfamily member 9 (chains A, B)
LEVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTH
NAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQAGTGVCRPWTNCSL
DGRSVLKTGTTEKDVVCGPLVPR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

Crystal structure of murine 4-1BB and its interaction with 4-1BBL support a role for galectin-9 in 4-1BB signaling. Bitra, A., Doukov, T., Wang, J. et al. J Biol Chem (2018) 293:1317-1329. DOI 10.1074/jbc.M117.814905 · PubMed

Other PDB entries of the same protein (UniProt P20334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
5WJF 2.6 Å, Crystal structure of murine 4-1BB from HEK293T cells in P21212 space group
6MKZ 2.65 Å, Crystal structure of murine 4-1BB/4-1BBL complex
5WI8 2.95 Å, Crystal structure of murine 4-1BB from HEK293T cells in P21 space group

Browse structure collections

About this viewer

MolViewer shows 5WIW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.