5WJF: PDB entry 5WJF

Crystal structure of murine 4-1BB from HEK293T cells in P21212 space group. Determined by X-ray diffraction at 2.6 Å resolution. Released 20 Dec 2017.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,117
Mol. weight: 31.92 kDa
Ligands: NAG
Released: 20 Dec 2017

Explore 5WJF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WJF contains 17 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-30	3
β-strand	35-38	4	1
β-strand	41-46	6	1
α-helix	47-48	2
β-strand	51-52	2	2
β-strand	58	1	1
α-helix	61	1
β-strand	62-63	2	2
α-helix	64-66	3
β-strand	71-75	5	3
β-strand	84-87	4	3
α-helix	88	1
β-strand	91-94	4	4
β-strand	100-103	4	4
α-helix	104-106	3
β-strand	109-112	4	5
β-strand	115-118	4	5
α-helix	119-120	2
β-strand	123-124	2	6
β-strand	134-135	2	6
α-helix	136-137	2
α-helix	139-141	3
β-strand	146-148	3	7
β-strand	157-158	2	7

Chain B: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	35-36	2	8
β-strand	45-46	2	8
α-helix	47-48	2
β-strand	51-52	2	9
α-helix	61	1
β-strand	62-63	2	9
α-helix	64-65	2
β-strand	69	1	3
β-strand	71-75	5	10
β-strand	84-87	4	10
α-helix	88	1
β-strand	91-94	4	11
β-strand	100-103	4	11
α-helix	104-105	2
β-strand	109-112	4	12
β-strand	115-118	4	12
α-helix	119-120	2
β-strand	123-124	2	13
β-strand	134-135	2	13
α-helix	136-137	2
β-strand	146-148	3	14
α-helix	155-156	2
β-strand	157-158	2	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 9	A, B	protein	143	Mus musculus	P20334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5WJF_1 Tumor necrosis factor receptor superfamily member 9 (chains A, B)
LEVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTH
NAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSL
DGRSVLKTGTTEKDVVCGPLVPR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal structure of murine 4-1BB and its interaction with 4-1BBL support a role for galectin-9 in 4-1BB signaling. Bitra, A., Doukov, T., Wang, J. et al. J Biol Chem (2018) 293:1317-1329. DOI 10.1074/jbc.M117.814905 · PubMed

Other PDB entries of the same protein (UniProt P20334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WIW 2.3 Å, Crystal structure of murine 4-1BB N128A mutant from HEK293T cells in P43 space group
1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
6MKZ 2.65 Å, Crystal structure of murine 4-1BB/4-1BBL complex
5WI8 2.95 Å, Crystal structure of murine 4-1BB from HEK293T cells in P21 space group

Browse structure collections

About this viewer

MolViewer shows 5WJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.