Thermolysin, SFX liganded form with water-based carrier. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Aug 2017.
Explore 5WR3 in 3D Show helices and sheets RCSB PDB PDBe
5WR3 contains 13 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-11 | 8 | 1 |
| β-strand | 17-25 | 9 | 1 |
| β-strand | 27-29 | 3 | 1 |
| β-strand | 31-32 | 2 | 2 |
| β-strand | 39-43 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| β-strand | 56-57 | 2 | 1 |
| β-strand | 61-62 | 2 | 1 |
| α-helix | 65-67 | 3 | |
| α-helix | 68-88 | 21 | |
| β-strand | 100-104 | 5 | 2 |
| β-strand | 113-115 | 3 | 2 |
| β-strand | 120-122 | 3 | 2 |
| β-strand | 130 | 1 | 3 |
| α-helix | 133-135 | 3 | |
| α-helix | 137-151 | 15 | |
| α-helix | 159-180 | 22 | |
| β-strand | 187-188 | 2 | 4 |
| β-strand | 193 | 1 | 3 |
| β-strand | 203-204 | 2 | 4 |
| α-helix | 208-211 | 4 | |
| α-helix | 217-219 | 3 | |
| α-helix | 225-229 | 5 | |
| α-helix | 234-246 | 13 | |
| β-strand | 248-250 | 3 | 5 |
| β-strand | 253-255 | 3 | 5 |
| α-helix | 260-269 | 10 | |
| α-helix | 270-274 | 5 | |
| α-helix | 281-296 | 16 | |
| α-helix | 301-312 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thermolysin | A | protein | 316 | Geobacillus stearothermophilus | P43133 (AlphaFold model) |
>5WR3_1 Thermolysin (chains A) ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADN QFFASYDAPAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQM VYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYA NKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKA AYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTS QEVASVKQAFDAVGVK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 4 |
| ZN | Zinc ion | Zn | 1 |
| NX6 | N-[(benzyloxy)carbonyl]-L-aspartic acid | C12 H13 N O6 | 1 |
Protein-ligand complex structure from serial femtosecond crystallography using soaked thermolysin microcrystals and comparison with structures from synchrotron radiation. Naitow, H., Matsuura, Y., Tono, K. et al. Acta Crystallogr D Struct Biol (2017) 73:702-709. DOI 10.1107/S2059798317008919 · PubMed
Other PDB entries of the same protein (UniProt P43133 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WR3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.