Crystal structure of human tyrosylprotein sulfotransferase-1 complexed with PAP and gastrin peptide. Determined by X-ray diffraction at 2.31 Å resolution. Released 6 Sept 2017.
Explore 5WRJ in 3D Show helices and sheets RCSB PDB PDBe
5WRJ contains 66 α-helices and 33 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 72-76 | 5 | 1 |
| α-helix | 82-90 | 9 | |
| β-strand | 95-96 | 2 | 2 |
| α-helix | 103-116 | 14 | |
| α-helix | 118-126 | 9 | |
| α-helix | 131-148 | 18 | |
| β-strand | 155-156 | 2 | 2 |
| β-strand | 157-159 | 3 | 1 |
| α-helix | 161-166 | 6 | |
| α-helix | 167-173 | 7 | |
| β-strand | 178-183 | 6 | 1 |
| α-helix | 186-195 | 10 | |
| α-helix | 208-229 | 22 | |
| β-strand | 234-238 | 5 | 1 |
| α-helix | 239-244 | 6 | |
| α-helix | 246-257 | 12 | |
| α-helix | 263-266 | 4 | |
| α-helix | 268-270 | 3 | |
| β-strand | 272 | 1 | 3 |
| β-strand | 278 | 1 | 3 |
| α-helix | 287-290 | 4 | |
| α-helix | 293-294 | 2 | |
| α-helix | 308-312 | 5 | |
| α-helix | 314-317 | 4 | |
| α-helix | 320-323 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 72-76 | 5 | 4 |
| α-helix | 82-90 | 9 | |
| β-strand | 95-96 | 2 | 5 |
| α-helix | 103-116 | 14 | |
| α-helix | 118-126 | 9 | |
| α-helix | 131-148 | 18 | |
| β-strand | 155-156 | 2 | 5 |
| β-strand | 157-159 | 3 | 4 |
| α-helix | 161-166 | 6 | |
| α-helix | 167-173 | 7 | |
| β-strand | 178-183 | 6 | 4 |
| α-helix | 186-195 | 10 | |
| α-helix | 208-229 | 22 | |
| β-strand | 234-238 | 5 | 4 |
| α-helix | 239-244 | 6 | |
| α-helix | 246-257 | 12 | |
| α-helix | 263-271 | 9 | |
| β-strand | 272 | 1 | 6 |
| β-strand | 278 | 1 | 6 |
| α-helix | 287-290 | 4 | |
| α-helix | 293-294 | 2 | |
| α-helix | 308-312 | 5 | |
| α-helix | 314-317 | 4 | |
| α-helix | 320-323 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 72-75 | 4 | 7 |
| α-helix | 82-90 | 9 | |
| β-strand | 95-96 | 2 | 8 |
| α-helix | 103-116 | 14 | |
| α-helix | 118-126 | 9 | |
| α-helix | 131-148 | 18 | |
| β-strand | 155-156 | 2 | 8 |
| β-strand | 157-159 | 3 | 7 |
| α-helix | 161-166 | 6 | |
| α-helix | 167-173 | 7 | |
| β-strand | 178-183 | 6 | 7 |
| α-helix | 186-195 | 10 | |
| α-helix | 208-229 | 22 | |
| β-strand | 234-238 | 5 | 7 |
| α-helix | 239-244 | 6 | |
| α-helix | 246-257 | 12 | |
| α-helix | 263-266 | 4 | |
| β-strand | 272 | 1 | 9 |
| β-strand | 278 | 1 | 9 |
| α-helix | 287-290 | 4 | |
| α-helix | 293-294 | 2 | |
| α-helix | 308-312 | 5 | |
| α-helix | 314-317 | 4 | |
| α-helix | 320-323 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 71-75 | 5 | 10 |
| α-helix | 82-90 | 9 | |
| β-strand | 95-96 | 2 | 10 |
| α-helix | 103-116 | 14 | |
| α-helix | 118-126 | 9 | |
| α-helix | 131-148 | 18 | |
| β-strand | 155-159 | 5 | 10 |
| α-helix | 161-166 | 6 | |
| α-helix | 167-173 | 7 | |
| β-strand | 178-183 | 6 | 10 |
| α-helix | 186-195 | 10 | |
| β-strand | 200 | 1 | 11 |
| α-helix | 208-229 | 22 | |
| β-strand | 234-238 | 5 | 10 |
| α-helix | 239-244 | 6 | |
| α-helix | 246-256 | 11 | |
| α-helix | 263-266 | 4 | |
| α-helix | 268-271 | 4 | |
| β-strand | 272 | 1 | 12 |
| β-strand | 278 | 1 | 12 |
| α-helix | 287-290 | 4 | |
| α-helix | 293-294 | 2 | |
| α-helix | 308-312 | 5 | |
| α-helix | 314-317 | 4 | |
| α-helix | 320-323 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1005 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein-tyrosine sulfotransferase 1 | A, B, C, D | protein | 303 | Homo sapiens | O60507 (AlphaFold model) |
| gastrin peptide | F, H, J, L | protein | 12 | synthetic construct | P01350 (AlphaFold model) |
>5WRJ_1 Protein-tyrosine sulfotransferase 1 (chains A, B, C, D) GSHMKLESTRTTVRTGLDLKANKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCG EETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCN KDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRA IETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGV SLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKP DPK
>5WRJ_2 gastrin peptide (chains F, H, J, L) EEEEEAYGWMDF
Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1. Tanaka, S., Nishiyori, T., Kojo, H. et al. Sci Rep (2017) 7:8776-8776. DOI 10.1038/s41598-017-07141-8 · PubMed
Other PDB entries of the same protein (UniProt O60507 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.