Crystal structure of the P2X4 receptor from zebrafish in the presence of CTP at 2.8 Angstroms. Determined by X-ray diffraction at 2.8 Å resolution. Released 5 Apr 2017.
Explore 5WZY in 3D Show helices and sheets RCSB PDB PDBe
5WZY contains 13 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-44 | 8 | |
| α-helix | 45-53 | 9 | |
| β-strand | 58-62 | 5 | 1 |
| β-strand | 64-72 | 9 | 2 |
| β-strand | 75-79 | 5 | 3 |
| β-strand | 83-87 | 5 | 3 |
| α-helix | 89-92 | 4 | |
| β-strand | 93 | 1 | 4 |
| β-strand | 101-120 | 20 | 4 |
| α-helix | 121-123 | 3 | |
| β-strand | 128 | 1 | 4 |
| α-helix | 132-134 | 3 | |
| β-strand | 147-154 | 8 | 4 |
| β-strand | 160-168 | 9 | 4 |
| α-helix | 170-172 | 3 | |
| α-helix | 175-177 | 3 | |
| α-helix | 183-187 | 5 | |
| β-strand | 189-198 | 10 | 2 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-206 | 4 | 2 |
| α-helix | 214-219 | 6 | |
| β-strand | 232-234 | 3 | 2 |
| α-helix | 235-241 | 7 | |
| α-helix | 246-252 | 7 | |
| β-strand | 254-261 | 8 | 4 |
| β-strand | 264-265 | 2 | 1 |
| β-strand | 276-281 | 6 | 4 |
| β-strand | 296-304 | 9 | 4 |
| β-strand | 310-327 | 18 | 4 |
| β-strand | 329-333 | 5 | 1 |
| α-helix | 335-358 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| p2X purinoceptor | A | protein | 340 | Danio rerio | F8W463 (AlphaFold model) |
>5WZY_1 p2X purinoceptor (chains A) GSSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGER IWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGD GVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNK RNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCD LDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVM VFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CTP | Cytidine-5'-triphosphate | C9 H16 N3 O14 P3 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (GOL) are not listed.
Structural insights into the nucleotide base specificity of P2X receptors. Kasuya, G., Fujiwara, Y., Tsukamoto, H. et al. Sci Rep (2017) 7:45208-45208. DOI 10.1038/srep45208 · PubMed
Other PDB entries of the same protein (UniProt F8W463 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.