5XM1: Histone H3mm7
The mouse nucleosome structure containing H2A, H2B type3-A, H3mm7, and H4. Determined by X-ray diffraction at 3.45 Å resolution. Released 7 Mar 2018.
- Method
- X-ray diffraction
- Resolution
- 3.45 Å
- Organisms
- Mus musculus, Homo sapiens
- Chains
- 10
- Atoms
- 11,920
- Mol. weight
- 202.25 kDa
- Released
- 7 Mar 2018
Explore 5XM1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5XM1 contains 39 α-helices and 20 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-75 | 12 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chains B and F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 97-98 | 2 | 3 |
Chain C: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-20 | 4 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-96 | 6 | |
| β-strand | 101-102 | 2 | 6 |
| α-helix | 113-115 | 3 | |
Chain D: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 5 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 4 |
| α-helix | 91-101 | 11 | |
| α-helix | 103 | 1 | |
| α-helix | 106-121 | 16 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 7 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 8 |
| α-helix | 121-131 | 11 | |
Chain G: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 9 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 10 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-96 | 6 | |
| β-strand | 101-102 | 2 | 3 |
| α-helix | 113-115 | 3 | |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 10 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 9 |
| α-helix | 91-101 | 11 | |
| α-helix | 106-123 | 18 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3mm7 | A, E | protein | 139 | Mus musculus | P84244 (AlphaFold model) |
| Histone H4 | B, F | protein | 106 | Mus musculus | P62806 (AlphaFold model) |
| Histone H2A type 1-B | C, G | protein | 133 | Mus musculus | C0HKE1 (AlphaFold model) |
| Histone H2B type 3-A | D, H | protein | 129 | Mus musculus | Q9D2U9 (AlphaFold model) |
| DNA (146-mer) | I, J | DNA | 146 | Homo sapiens | |
Sequence of entity 1 (A, E), FASTA
>5XM1_1 Histone H3mm7 (chains A, E)
GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPSIGGVKKPHRYRPGTVALREIRRYQK
ATELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR
VTIMPKDIQLARRIRGERA
Sequence of entity 2 (B, F), FASTA
>5XM1_2 Histone H4 (chains B, F)
GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG
VLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G), FASTA
>5XM1_3 Histone H2A type 1-B (chains C, G)
GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLE
YLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLL
PKKTESHHKAKGK
Sequence of entity 4 (D, H), FASTA
>5XM1_4 Histone H2B type 3-A (chains D, H)
GSHMPEPSRSTPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISS
KAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTK
AVTKYTSSK
Sequence of entity 5 (I, J), FASTA
>5XM1_5 DNA (146-MER) (chains I, J)
ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGC
ATGTTCAGCTGAATTCAGCTGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTT
GGTAGAATCTGCAGGTGGATATTGAT
Primary citation
Histone H3.3 sub-variant H3mm7 is required for normal skeletal muscle regeneration. Harada, A., Maehara, K., Ono, Y. et al. Nat Commun (2018) 9:1400-1400. DOI 10.1038/s41467-018-03845-1 · PubMed
Other PDB entries of the same protein (UniProt P84244 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8PKJ 2.5 Å, Cryo-EM structure of the nucleosome containing Nr5a2 motif at SHL+5.5
- 8PKI 2.58 Å, Cryo-EM structure of NR5A2-nucleosome complex SHL+5.5
- 5XM0 2.87 Å, The mouse nucleosome structure containing H2A, H2B type3-A, H3.3, and H4
- 2RVN Solution structure of the chromodomain of HP1a with the phosphorylated N-terminal tail…
Browse structure collections
About this viewer
MolViewer shows 5XM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.