5XRK: Galectin-10

Galectin-10/Charcot-Leyden crystal protein variant C57A crystal structure. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Jan 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,301
Mol. weight: 16.81 kDa
Released: 24 Jan 2018

Explore 5XRK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XRK contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	8-11	4	2
β-strand	19-26	8	1
α-helix	30-32	3
β-strand	35-41	7	2
β-strand	50-57	8	2
β-strand	61-68	8	2
β-strand	71-72	2	2
β-strand	76-78	3	2
β-strand	89-95	7	1
β-strand	99-104	6	1
β-strand	107-113	7	1
α-helix	118-120	3
β-strand	123-128	6	2
β-strand	130-137	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin-10	A	protein	145	Homo sapiens	Q05315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XRK_1 Galectin-10 (chains A)
GSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVA
FGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIK
PEAVKMVQVWRDISLTKFNVSYLKR

Primary citation

Galectin-10: a new structural type of prototype galectin dimer and effects on saccharide ligand binding. Su, J., Gao, J., Si, Y. et al. Glycobiology (2018) 28:159-168. DOI 10.1093/glycob/cwx107 · PubMed

Other PDB entries of the same protein (UniProt Q05315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GKS 1.38 Å, X-ray structure determined from recombinant Charcot-Leyden crystal
6QRN 1.4 Å, Galectin-10 complexed with ribose
5XRG 1.55 Å, Galectin-10/Charcot-Leyden crystal protein crystal structure
5XRH 1.55 Å, Galectin-10/Charcot-Leyden crystal protein crystal structure
9UWN 1.57 Å, Crystal structure of E33A mutant of human galectin-10 produced by cell-free protein…
9UWP 1.57 Å, Crystal structure of human galectin-10 produced by cell-free protein synthesis in…
5XRN 1.6 Å, Galectin-10/Charcot-Leyden crystal protein variant K73A crystal structure
5XRO 1.6 Å, Galectin-10/Charcot-Leyden crystal protein variant Q74A crystal structure
9UWK 1.6 Å, Crystal structure of human galectin-10 produced by cell-free protein synthesis
6A1U 1.62 Å, Charcot-Leyden crystal protein/Galectin-10 variant E33D
8JAE 1.62 Å, Crystal structure of E33A mutant human galectin-10 produced by cell-free protein…
6A1S 1.63 Å, Charcot-Leyden crystal protein/Galectin-10 variant E33A

Browse structure collections

About this viewer

MolViewer shows 5XRK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.