Galectin-10/Charcot-Leyden crystal protein variant C57A crystal structure. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Jan 2018.
Explore 5XRK in 3D Show helices and sheets RCSB PDB PDBe
5XRK contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 1 |
| β-strand | 8-11 | 4 | 2 |
| β-strand | 19-26 | 8 | 1 |
| α-helix | 30-32 | 3 | |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 50-57 | 8 | 2 |
| β-strand | 61-68 | 8 | 2 |
| β-strand | 71-72 | 2 | 2 |
| β-strand | 76-78 | 3 | 2 |
| β-strand | 89-95 | 7 | 1 |
| β-strand | 99-104 | 6 | 1 |
| β-strand | 107-113 | 7 | 1 |
| α-helix | 118-120 | 3 | |
| β-strand | 123-128 | 6 | 2 |
| β-strand | 130-137 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-10 | A | protein | 145 | Homo sapiens | Q05315 (AlphaFold model) |
>5XRK_1 Galectin-10 (chains A) GSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVA FGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIK PEAVKMVQVWRDISLTKFNVSYLKR
Galectin-10: a new structural type of prototype galectin dimer and effects on saccharide ligand binding. Su, J., Gao, J., Si, Y. et al. Glycobiology (2018) 28:159-168. DOI 10.1093/glycob/cwx107 · PubMed
Other PDB entries of the same protein (UniProt Q05315 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XRK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.