Hetero-micro-seeding: Crystal structure of BPTI-[555]C14GA38I variant using micro-seeds from -C14GA38L variant. Determined by X-ray diffraction at 1.3 Å resolution. Released 4 Jul 2018.
Explore 5XX8 in 3D Show helices and sheets RCSB PDB PDBe
5XX8 contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 8-9 | 2 | |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 29-35 | 7 | 1 |
| β-strand | 45 | 1 | 1 |
| α-helix | 48-55 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pancreatic trypsin inhibitor | A, B | protein | 58 | Bos taurus | P00974 (AlphaFold model) |
>5XX8_1 Pancreatic trypsin inhibitor (chains A, B) RPDFCLEPPYTGPGKARIIRYFYNAKAGLAQTFVYGGIRAKRNNFKSAEDALRTCGGA
A hetero-micro-seeding strategy for readily crystallizing closely related protein variants. Islam, M.M., Kuroda, Y. Biochem Biophys Res Commun (2017) 493:504-508. DOI 10.1016/j.bbrc.2017.08.161 · PubMed
Other PDB entries of the same protein (UniProt P00974 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5XX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.