5XXJ: SmyD3

Crystal structure of SmyD3 in complex with covalent inhibitor 3. Determined by X-ray diffraction at 1.69 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,569
Mol. weight: 49.71 kDa
Ligands: ZN, 8HF, SAM
Released: 8 Aug 2018

Explore 5XXJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XXJ contains 27 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	16-20	5	1
β-strand	24	1	2
β-strand	29-33	5	3
β-strand	37-40	4	4
α-helix	42-44	3
β-strand	45	1	5
β-strand	48	1	5
β-strand	55	1	5
β-strand	60-61	2	6
α-helix	62	1
β-strand	69-70	2	6
α-helix	73-91	19
α-helix	97-99	3
α-helix	100-114	15
α-helix	116-118	3
α-helix	119-121	3
α-helix	126-128	3
α-helix	133-135	3
α-helix	138-154	17
α-helix	162-164	3
α-helix	166	1
α-helix	171-181	11
β-strand	182-186	5	4
β-strand	192-197	6	4
α-helix	201-203	3
α-helix	204	1
β-strand	205-206	2	7
β-strand	212-217	6	3
β-strand	220-225	6	3
β-strand	229	1	2
α-helix	233	1
β-strand	234	1	1
α-helix	235	1
β-strand	236-237	2	7
α-helix	246-257	12
α-helix	264-268	5
α-helix	272-275	4
α-helix	280-298	19
α-helix	302-313	12
α-helix	325-340	16
α-helix	344-361	18
α-helix	367-382	16
α-helix	386-403	18
α-helix	409-424	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMYD3	A	protein	423	Homo sapiens	Q9H7B4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XXJ_1 SMYD3 (chains A)
PLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRC
SQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEK
LYSFYDLESNINKLTEDRKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNS
FTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDM
LMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKW
EQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFF
PGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECD
ANI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
8HF	propyl (2~{R})-4-[4-chloranyl-2-[4-(2-oxidanylpropan-2-yl)phenyl]quinolin-7-yl]…	C28 H32 Cl N3 O4	1
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Primary citation

Crystal structure of SmyD3 in complex with covalent inhibitor 3. Baburajendran, N., Jansson, A.E. To be published.

Other PDB entries of the same protein (UniProt Q9H7B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6P7Z 1.19 Å, Co-crystal Structure of human SMYD3 with Isoxazole Amides Inhibitors
6PAF 1.24 Å, Co-crystal Structure of human SMYD3 with Isoxazole Amides Inhibitors
5V37 1.42 Å, Crystal structure of SMYD3 with SAM and EPZ028862
5CCL 1.5 Å, Crystal structure of SMYD3 with SAM and oxindole compound
7O2C 1.52 Å, X-RAY STRUCTURE OF SMYD3 IN COMPLEX WITH the benzodiazepine-based probe BAY-6035
3QWP 1.53 Å, Crystal structure of SET and MYND domain containing 3; Zinc finger MYND…
6P6K 1.55 Å, Co-crystal Structure of human SMYD3 with Isoxazole Amides Inhibitors
6ZRB 1.55 Å, Crystal structure of SMYD3 conjugate with piperidine-based covalent inhibitor EM127
7O2A 1.57 Å, X-RAY STRUCTURE OF SMYD3 IN COMPLEX WITH benzodiazepine-type inhibitor compound 15
7QNR 1.57 Å, SMYD3 in complex with fragment FL01791
6O9O 1.59 Å, Crystal Structure of SMYD3 with Potent and Selective Isoxazole Amide Inhibitor 1
6P6G 1.59 Å, Co-crystal Structure of human SMYD3 with Isoxazole Amides Inhibitors

Browse structure collections

About this viewer

MolViewer shows 5XXJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.