5Y0U: AEBP2 C2H2 zinc fingers

The solution structure of AEBP2 C2H2 zinc fingers. Determined by solution NMR. Released 1 Aug 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 855
Mol. weight: 12.38 kDa
Ligands: ZN
Released: 1 Aug 2018

Explore 5Y0U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y0U contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	261-262	2	1
β-strand	265	1	2
β-strand	268	1	2
β-strand	271-272	2	1
α-helix	275-281	7
α-helix	282-287	6
α-helix	288-290	3
β-strand	295	1	3
β-strand	299	1	2
β-strand	300	1	4
β-strand	302	1	4
β-strand	309	1	3
α-helix	312-323	12
β-strand	328-329	2	5
α-helix	330	1
β-strand	338-339	2	5
α-helix	342-352	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger protein AEBP2	A	protein	109	Homo sapiens	Q6ZN18 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Y0U_1 Zinc finger protein AEBP2 (chains A)
MGHHHHHHNNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTP
STSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural and biochemical insights into human zinc finger protein AEBP2 reveals interactions with RBBP4. Sun, A., Li, F., Liu, Z. et al. Protein Cell (2018) 9:738-742. DOI 10.1007/s13238-017-0483-6 · PubMed

Other PDB entries of the same protein (UniProt Q6ZN18 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y1U 2.14 Å, Crystal structure of RBBP4 bound to AEBP2 RRK motif
5WAI 2.9 Å, Crystal Structure of a Suz12-Rbbp4-Jarid2-Aebp2 Heterotetrameric Complex
9KOF 3.07 Å, Structure of human PRC2 with SAH and H3K27me3 peptide
8VMI 3.1 Å, PRC2_AJ119-450 bound to H3K4me3
8VNV 3.1 Å, PRC2_AJ1-450 bound to H3K36me3 with histone H3 tail engaged
9C8U 3.1 Å, Human PRC2 - RvLEAM (short) (1:6 molar ratio), cross-linked 10 min
9KOH 3.1 Å, Structure of human PRC2-SAH-H3K27me3-C36
8FYH 3.4 Å, G4 RNA-mediated PRC2 dimer
9DCH 3.4 Å, Single-stranded RNA-mediated PRC2 dimer
6C24 3.5 Å, Cryo-EM structure of PRC2 bound to cofactors AEBP2 and JARID2 in the Extended Active State
6WKR 3.5 Å, PRC2-AEBP2-JARID2 bound to H2AK119ub1 nucleosome
8VML 3.5 Å, PRC2_AJ1-450 bound to H3K4me3

Browse structure collections

About this viewer

MolViewer shows 5Y0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.