5Y7L: PDB entry 5Y7L

Solution structure of Hbeta4 extracellular loop of BK potassium channel. Determined by solution NMR. Released 1 Aug 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 987
Mol. weight: 14.11 kDa
Released: 1 Aug 2018

Explore 5Y7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y7L contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	51	1	1
β-strand	53-56	4	2
β-strand	66-72	7	3
β-strand	76-82	7	3
β-strand	89-92	4	2
β-strand	96-98	3	2
α-helix	104-109	6
α-helix	128-140	13
β-strand	146-151	6	1
β-strand	158-163	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-activated potassium channel subunit beta-4	A	protein	122	Homo sapiens	Q86W47 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Y7L_1 Calcium-activated potassium channel subunit beta-4 (chains A)
QDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDE
HQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRT
HD

Primary citation

Solution structure of extracellular loop of human beta 4 subunit of BK channel and its biological implication on ChTX sensitivity. Wang, Y., Lan, W., Yan, Z. et al. Sci Rep (2018) 8:4571-4571. DOI 10.1038/s41598-018-23016-y · PubMed

Other PDB entries of the same protein (UniProt Q86W47 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CZM 2.57 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in nanodisc.
9CZO 2.87 Å, Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in nanodisc.
9CZQ 2.88 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent.
9D18 2.88 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 2 of…
9D19 2.88 Å, Ca2+ bound open-inactivated hSlo1 + beta2N-beta4 channel in detergent-conformation 3 of…
9CZH 2.9 Å, Ca2+ bound intermediate state of hSlo1 + beta2N-beta4 channel in detergent.
6V22 3.2 Å, Cryo-EM structure of Ca2+-bound hsSlo1-beta4 channel complex
6V35 3.5 Å, Cryo-EM structure of Ca2+-free hsSlo1-beta4 channel complex
9CZK 3.5 Å, Ca2+ free hSlo1 + beta2N-beta4 channel in nanodisc.
9CZJ 3.54 Å, Ca2+ free hSlo1 + beta2N-beta4 channel in detergent.

Browse structure collections

About this viewer

MolViewer shows 5Y7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.