Crystal structure of LsrK-HPr complex with ADP. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Jul 2018.
Explore 5YA2 in 3D Show helices and sheets RCSB PDB PDBe
5YA2 contains 61 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-19 | 7 | 1 |
| β-strand | 24-30 | 7 | 1 |
| β-strand | 35-41 | 7 | 1 |
| α-helix | 59-77 | 19 | |
| α-helix | 81-83 | 3 | |
| β-strand | 84-91 | 8 | 1 |
| β-strand | 96-99 | 4 | 2 |
| α-helix | 101-103 | 3 | |
| β-strand | 105-109 | 5 | 2 |
| α-helix | 114-116 | 3 | |
| α-helix | 117-124 | 8 | |
| α-helix | 126-129 | 4 | |
| α-helix | 131-139 | 9 | |
| α-helix | 148-157 | 10 | |
| α-helix | 159-162 | 4 | |
| β-strand | 167-170 | 4 | 2 |
| α-helix | 171-180 | 10 | |
| β-strand | 185 | 1 | 3 |
| α-helix | 187-190 | 4 | |
| α-helix | 191-193 | 3 | |
| β-strand | 196-197 | 2 | 4 |
| β-strand | 202-203 | 2 | 4 |
| α-helix | 205-211 | 7 | |
| α-helix | 215-218 | 4 | |
| β-strand | 221 | 1 | 3 |
| β-strand | 227-230 | 4 | 1 |
| α-helix | 233-239 | 7 | |
| β-strand | 246-252 | 7 | 1 |
| α-helix | 253-260 | 8 | |
| β-strand | 269-273 | 5 | 5 |
| β-strand | 277-283 | 7 | 5 |
| β-strand | 295-298 | 4 | 5 |
| β-strand | 305-311 | 7 | 5 |
| α-helix | 315-324 | 10 | |
| α-helix | 326-328 | 3 | |
| α-helix | 329-336 | 8 | |
| α-helix | 340-349 | 10 | |
| α-helix | 355-357 | 3 | |
| β-strand | 359-361 | 3 | 6 |
| β-strand | 377-379 | 3 | 6 |
| α-helix | 390-416 | 27 | |
| β-strand | 423-426 | 4 | 5 |
| α-helix | 428-431 | 4 | |
| α-helix | 433-443 | 11 | |
| β-strand | 447-450 | 4 | 5 |
| α-helix | 456-468 | 13 | |
| α-helix | 474-481 | 8 | |
| β-strand | 484-488 | 5 | 5 |
| α-helix | 489-491 | 3 | |
| α-helix | 492-502 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-19 | 7 | 7 |
| β-strand | 23-30 | 8 | 7 |
| β-strand | 35-42 | 8 | 7 |
| α-helix | 59-77 | 19 | |
| α-helix | 81-83 | 3 | |
| β-strand | 84-91 | 8 | 7 |
| β-strand | 96-99 | 4 | 8 |
| α-helix | 101-103 | 3 | |
| β-strand | 105-109 | 5 | 8 |
| α-helix | 117-124 | 8 | |
| α-helix | 126-129 | 4 | |
| α-helix | 131-139 | 9 | |
| α-helix | 148-157 | 10 | |
| α-helix | 159-162 | 4 | |
| β-strand | 167-170 | 4 | 8 |
| α-helix | 171-180 | 10 | |
| β-strand | 185 | 1 | 9 |
| α-helix | 187-190 | 4 | |
| α-helix | 191-193 | 3 | |
| β-strand | 196-197 | 2 | 10 |
| β-strand | 202-203 | 2 | 10 |
| α-helix | 205-211 | 7 | |
| α-helix | 215-218 | 4 | |
| β-strand | 221 | 1 | 9 |
| β-strand | 227-230 | 4 | 7 |
| α-helix | 233-239 | 7 | |
| β-strand | 246-252 | 7 | 7 |
| α-helix | 253-260 | 8 | |
| β-strand | 269-273 | 5 | 11 |
| β-strand | 277-283 | 7 | 11 |
| β-strand | 295-298 | 4 | 11 |
| β-strand | 305-311 | 7 | 11 |
| α-helix | 315-324 | 10 | |
| α-helix | 326-328 | 3 | |
| α-helix | 329-336 | 8 | |
| α-helix | 340-349 | 10 | |
| α-helix | 355-357 | 3 | |
| β-strand | 359-361 | 3 | 12 |
| β-strand | 377-379 | 3 | 12 |
| α-helix | 390-416 | 27 | |
| β-strand | 423-426 | 4 | 11 |
| α-helix | 428-431 | 4 | |
| α-helix | 433-443 | 11 | |
| β-strand | 447-450 | 4 | 11 |
| α-helix | 456-468 | 13 | |
| α-helix | 474-481 | 8 | |
| β-strand | 484-488 | 5 | 11 |
| α-helix | 489-491 | 3 | |
| α-helix | 492-503 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 13 |
| α-helix | 16-26 | 11 | |
| β-strand | 32-37 | 6 | 13 |
| β-strand | 40-43 | 4 | 13 |
| α-helix | 47-51 | 5 | |
| β-strand | 60-66 | 7 | 13 |
| α-helix | 70-82 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autoinducer-2 kinase | A, B | protein | 540 | Escherichia coli (strain K12) | P77432 (AlphaFold model) |
| Phosphocarrier protein HPr | C, D | protein | 85 | Escherichia coli (strain K12) | P0AA04 (AlphaFold model) |
>5YA2_1 Autoinducer-2 kinase (chains A, B) HHHHHHSEDPMARLFTLSESKYYLMALDAGTGSIRAVIFDLEGNQIAVGQAEWRHLAVPD VPGSMEFDLNKNWQLACECMRQALHNAGIAPEYIAAVSACSMREGIVLYNNEGAPIWACA NVDARAAREVSELKELHNNTFENEVYRATGQTLALSAIPRLLWLAHHRSDIYRQASTITM ISDWLAYMLSGELAVDPSNAGTTGLLDLTTRDWKPALLDMAGLRADILSPVKETGTLLGV VSSQAAELCGLKAGTPVVVGGGDVQLGCLGLGVVRPAQTAVLGGTFWQQVVNLAAPVTDP EMNVRVNPHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLIAERLGIDTYTLLEEMASR VPPGSWGVMPIFSDRMRFKTWYHAAPSFINLSIDPDKCNKATLFRALEENAAIVSACNLQ QIADFSNIHPSSLVFAGGGSKGKLWSQILADVSGLPVNIPVVKEATALGCAIAAGVGAGI FSSMAETGERLVRWERTHTPDPEKHELYQDSRDKWQAVYQDQLGLVDHGLTTSLWKAPGL
>5YA2_2 Phosphocarrier protein HPr (chains C, D) MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV VTISAEGEDEQKAVEHLVKLMAELE
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 6 |
| HEZ | Hexane-1,6-diol | C6 H14 O2 | 2 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 2 |
Evidence of link between quorum sensing and sugar metabolism inEscherichia colirevealed via cocrystal structures of LsrK and HPr. Ha, J.H., Hauk, P., Cho, K. et al. Sci Adv (2018) 4:eaar7063-eaar7063. DOI 10.1126/sciadv.aar7063 · PubMed
Other PDB entries of the same protein (UniProt P77432 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YA2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.