Crystal structure of AL3 PHD finger bound to H3K4me2. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Jan 2018.
Explore 5YC3 in 3D Show helices and sheets RCSB PDB PDBe
5YC3 contains 1 α-helix and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| β-strand | 19-22 | 4 | 1 |
| β-strand | 29-31 | 3 | 1 |
| α-helix | 39-42 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein ALFIN-LIKE 3 | A | protein | 60 | Arabidopsis thaliana | Q9M2B4 (AlphaFold model) |
| H3K4me2 | P | protein | 9 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>5YC3_1 PHD finger protein ALFIN-LIKE 3 (chains A) GPLGSDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSN
>5YC3_2 H3K4me2 (chains P) ARTKQTARK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Systematic Profiling of Histone Readers in Arabidopsis thaliana. Zhao, S., Zhang, B., Yang, M. et al. Cell Rep (2018) 22:1090-1102. DOI 10.1016/j.celrep.2017.12.099 · PubMed
Other PDB entries of the same protein (UniProt Q9M2B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.