A kinase complex MST4-MOB4. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Aug 2018.
Explore 5YF4 in 3D Show helices and sheets RCSB PDB PDBe
5YF4 contains 7 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 68-88 | 21 | |
| β-strand | 100 | 1 | 1 |
| β-strand | 106-108 | 3 | 1 |
| α-helix | 109 | 1 | |
| β-strand | 110 | 1 | 2 |
| β-strand | 117 | 1 | 2 |
| α-helix | 121-137 | 17 | |
| α-helix | 155-173 | 19 | |
| α-helix | 175-185 | 11 | |
| α-helix | 187-197 | 11 | |
| α-helix | 203-205 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 329-331 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MOB-like protein phocein | A | protein | 162 | Homo sapiens | Q9Y3A3 (AlphaFold model) |
| Peptide from Serine/threonine-protein kinase 26 | B | protein | 16 | Homo sapiens | Q9P289 (AlphaFold model) |
>5YF4_1 MOB-like protein phocein (chains A) STMENIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIF LCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFS HAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI
>5YF4_2 Peptide from Serine/threonine-protein kinase 26 (chains B) THPEWSFTTVRKKPDP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
The MST4-MOB4 complex disrupts the MST1-MOB1 complex in the Hippo-YAP pathway and plays a pro-oncogenic role in pancreatic cancer. Chen, M., Zhang, H., Shi, Z. et al. J Biol Chem (2018) 293:14455-14469. DOI 10.1074/jbc.RA118.003279 · PubMed
Other PDB entries of the same protein (UniProt Q9Y3A3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.