5YF4: A kinase complex MST4-MOB4

A kinase complex MST4-MOB4. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Aug 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,215
Mol. weight: 21.16 kDa
Ligands: ZN
Released: 15 Aug 2018

Explore 5YF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YF4 contains 7 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	68-88	21
β-strand	100	1	1
β-strand	106-108	3	1
α-helix	109	1
β-strand	110	1	2
β-strand	117	1	2
α-helix	121-137	17
α-helix	155-173	19
α-helix	175-185	11
α-helix	187-197	11
α-helix	203-205	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	329-331	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB-like protein phocein	A	protein	162	Homo sapiens	Q9Y3A3 (AlphaFold model)
Peptide from Serine/threonine-protein kinase 26	B	protein	16	Homo sapiens	Q9P289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5YF4_1 MOB-like protein phocein (chains A)
STMENIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIF
LCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFS
HAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPI

Sequence of entity 2 (B), FASTA

>5YF4_2 Peptide from Serine/threonine-protein kinase 26 (chains B)
THPEWSFTTVRKKPDP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The MST4-MOB4 complex disrupts the MST1-MOB1 complex in the Hippo-YAP pathway and plays a pro-oncogenic role in pancreatic cancer. Chen, M., Zhang, H., Shi, Z. et al. J Biol Chem (2018) 293:14455-14469. DOI 10.1074/jbc.RA118.003279 · PubMed

Other PDB entries of the same protein (UniProt Q9Y3A3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7K36 3.3 Å, Cryo-EM structure of STRIPAK complex

Browse structure collections

About this viewer

MolViewer shows 5YF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.