5YJE: HIRA(644-1017)

Crystal structure of HIRA(644-1017). Determined by X-ray diffraction at 2.45 Å resolution. Released 20 Jun 2018.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,838
Mol. weight: 126.24 kDa
Released: 20 Jun 2018

Explore 5YJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5YJE contains 34 α-helices and 55 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	684-688	5
β-strand	691-695	5	1
β-strand	702-713	12	1
β-strand	716-725	10	1
β-strand	728-734	7	1
β-strand	738-743	6	2
β-strand	747-752	6	2
β-strand	756-761	6	2
β-strand	766-772	7	2
β-strand	777-783	7	3
β-strand	786-791	6	3
β-strand	795-800	6	3
β-strand	805-812	8	3
α-helix	814-817	4
β-strand	824-829	6	4
β-strand	835-839	5	4
β-strand	843-848	6	4
β-strand	853-859	7	4
α-helix	860-862	3
α-helix	885-890	6
α-helix	898-903	6
α-helix	908-928	21
α-helix	932-949	18
α-helix	952-963	12
β-strand	977-978	2	5
β-strand	981-982	2	5
α-helix	983-995	13
α-helix	998-1000	3
α-helix	1001-1015	15

Chain B: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	683-688	6
β-strand	691-695	5	6
β-strand	702-713	12	6
β-strand	716-725	10	6
β-strand	728-734	7	6
β-strand	738-743	6	7
β-strand	747-752	6	7
β-strand	756-761	6	7
β-strand	766	1	7
α-helix	769-770	2
β-strand	771-772	2	7
α-helix	773	1
β-strand	777-783	7	8
β-strand	786-791	6	8
β-strand	795-800	6	8
β-strand	805-812	8	8
α-helix	814-817	4
β-strand	826-829	4	2
β-strand	835-838	4	2
β-strand	843-848	6	2
β-strand	853-859	7	2
α-helix	865-867	3
α-helix	885-889	5
α-helix	901-903	3
α-helix	908-928	21
α-helix	932-949	18
α-helix	952-962	11
β-strand	977-978	2	9
β-strand	981-982	2	9
α-helix	983-995	13
α-helix	1001-1012	12
α-helix	1013-1015	3

Chain C: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	683-688	6
β-strand	691-695	5	10
β-strand	702-713	12	10
β-strand	716-725	10	10
β-strand	728-734	7	10
β-strand	738-743	6	4
β-strand	747-752	6	4
β-strand	756-761	6	4
β-strand	766-772	7	4
β-strand	777-783	7	11
β-strand	786-791	6	11
β-strand	795-800	6	11
β-strand	805-812	8	11
α-helix	813-816	4
β-strand	824-829	6	7
β-strand	835-839	5	7
β-strand	843-848	6	7
β-strand	853-859	7	7
α-helix	885-890	6
α-helix	900-903	4
α-helix	908-928	21
α-helix	932-949	18
α-helix	952-963	12
β-strand	977-978	2	12
β-strand	981-982	2	12
α-helix	983-995	13
α-helix	998-1000	3
α-helix	1001-1006	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein HIRA	A, B, C	protein	380	Homo sapiens	P54198 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5YJE_1 Protein HIRA (chains A, B, C)
MGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDPSM
YIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFST
CGRRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDM
TVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLC
SGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVY
ARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQR
LFTECQEQLDILRDKLEGSS

Primary citation

Functional activity of the H3.3 histone chaperone complex HIRA requires trimerization of the HIRA subunit. Ray-Gallet, D., Ricketts, M.D., Sato, Y. et al. Nat Commun (2018) 9:3103-3103. DOI 10.1038/s41467-018-05581-y · PubMed

Other PDB entries of the same protein (UniProt P54198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I32 2.7 Å, Structure of a human ASF1a-HIRA complex and insights into specificity of histone…

Browse structure collections

About this viewer

MolViewer shows 5YJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.