Crystal Structure of flavodoxin without engineered disulfide bond. Determined by X-ray diffraction at 1.14 Å resolution. Released 27 Dec 2017.
Explore 5YOB in 3D Show helices and sheets RCSB PDB PDBe
5YOB contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 14-28 | 15 | |
| β-strand | 32-37 | 6 | 1 |
| α-helix | 38-40 | 3 | |
| β-strand | 52-57 | 6 | 1 |
| β-strand | 59-60 | 2 | 2 |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 72-76 | 5 | |
| α-helix | 78-80 | 3 | |
| β-strand | 87-94 | 8 | 1 |
| α-helix | 103-114 | 12 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 122-123 | 2 | |
| β-strand | 124-127 | 4 | 1 |
| α-helix | 130-133 | 4 | |
| α-helix | 134-146 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Flavodoxin | A | protein | 148 | Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303) | P00323 (AlphaFold model) |
>5YOB_1 Flavodoxin (chains A) SAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTW GDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEYFCGAVDAIEEKLKNLGAEIV QDGLRIDGDPRAARDDIVGWAHDVRGAI
| ID | Name | Formula | Copies |
|---|---|---|---|
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 1 |
Water and common crystallization additives (GOL) are not listed.
Protein crystal quality oriented disulfide bond engineering. Pu, M., Xu, Z., Peng, Y. et al. Protein Cell (2018) 9:659-663. DOI 10.1007/s13238-017-0482-7 · PubMed
Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.