Structure of Beclin1-UVRAG coiled coil domain complex. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Jun 2018.
Explore 5YR0 in 3D Show helices and sheets RCSB PDB PDBe
5YR0 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 176-221 | 46 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 232-273 | 42 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beclin-1 | A | protein | 50 | Mus musculus | O88597 (AlphaFold model) |
| UV radiation resistance associated protein | B | protein | 48 | Mus musculus | Q8K245 (AlphaFold model) |
>5YR0_1 Beclin-1 (chains A) DSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQE
>5YR0_2 UV radiation resistance associated protein (chains B) TSNELKKESESLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKG
Targeting the potent Beclin 1-UVRAG coiled-coil interaction with designed peptides enhances autophagy and endolysosomal trafficking. Wu, S., He, Y., Qiu, X. et al. Proc Natl Acad Sci U S A (2018) 115:E5669-E5678. DOI 10.1073/pnas.1721173115 · PubMed
Other PDB entries of the same protein (UniProt O88597 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.