Crystal structure of SDG8 CW domain in complex with H3K4me1 peptide. Determined by X-ray diffraction at 1.59 Å resolution. Released 14 Mar 2018.
Explore 5YVX in 3D Show helices and sheets RCSB PDB PDBe
5YVX contains 4 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 863-867 | 5 | 1 |
| β-strand | 874-878 | 5 | 1 |
| α-helix | 879-882 | 4 | |
| α-helix | 893-895 | 3 | |
| α-helix | 907-908 | 2 | |
| α-helix | 912-919 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase ASHH2 | A | protein | 60 | Arabidopsis thaliana | Q2LAE1 (AlphaFold model) |
| H3K4me1 | C | protein | 9 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>5YVX_1 Histone-lysine N-methyltransferase ASHH2 (chains A) ESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINAELGI
>5YVX_2 H3K4me1 (chains C) ARTKQTARK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Uncovering the mechanistic basis for specific recognition of monomethylated H3K4 by the CW domain ofArabidopsishistone methyltransferase SDG8. Liu, Y., Huang, Y. J Biol Chem (2018) 293:6470-6481. DOI 10.1074/jbc.RA117.001390 · PubMed
Other PDB entries of the same protein (UniProt Q2LAE1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5YVX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.