5Z2Q: Vgll1-TEAD4 core complex

Vgll1-TEAD4 core complex. Determined by X-ray diffraction at 2.74 Å resolution. Released 31 Jan 2018.

Method: X-ray diffraction
Resolution: 2.74 Å
Organism: Mus musculus
Chains: 4
Atoms: 4,148
Mol. weight: 64.66 kDa
Ligands: PO4
Released: 31 Jan 2018

Explore 5Z2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z2Q contains 20 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	213	1	3
β-strand	218-227	10	3
β-strand	237-244	8	3
α-helix	245-248	4
α-helix	253-255	3
β-strand	256-259	4	2
α-helix	260-266	7
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	2
β-strand	306-315	10	3
β-strand	320-329	10	2
β-strand	332-342	11	2
β-strand	344-346	3	3
β-strand	349-358	10	3
α-helix	359	1
α-helix	361-371	11
α-helix	376-384	9
β-strand	386-394	9	2
β-strand	400-410	11	2
β-strand	418-425	8	2

Chain B: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	205-208	4
β-strand	213	1	4
β-strand	218-227	10	4
β-strand	237-244	8	4
α-helix	245-249	5
α-helix	253-256	4
β-strand	257-259	3	1
α-helix	260-262	3
α-helix	264-266	3
α-helix	274-280	7
α-helix	283-285	3
β-strand	286-293	8	1
β-strand	306-315	10	4
β-strand	320-329	10	1
β-strand	332-342	11	1
β-strand	344-346	3	4
β-strand	349-358	10	4
α-helix	359	1
α-helix	361-371	11
α-helix	376-384	9
β-strand	386-394	9	1
β-strand	400-410	11	1
β-strand	418-425	8	1

Chains C and D: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
β-strand	27-31	5	1
α-helix	37-49	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription cofactor vestigial-like protein 1	C	protein	48	Mus musculus	Q99NC0 (AlphaFold model)
Transcription cofactor vestigial-like protein 1	D	protein	49	Mus musculus	Q99NC0 (AlphaFold model)
Transcriptional enhancer factor TEF-3	A	protein	226	Mus musculus	Q62296 (AlphaFold model)
Transcriptional enhancer factor TEF-3	B	protein	228	Mus musculus	Q62296 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>5Z2Q_1 Transcription cofactor vestigial-like protein 1 (chains C)
MGSSHHHHHHSQDPKTEWNAGSVIFTYFEGDINSMVDEHFSRALRNLK

Sequence of entity 2 (D), FASTA

>5Z2Q_2 Transcription cofactor vestigial-like protein 1 (chains D)
MGSSHHHHHHSQDPKTEWNAGSVIFTYFEGDINSMVDEHFSRALRNLKR

Sequence of entity 3 (A), FASTA

>5Z2Q_3 Transcriptional enhancer factor TEF-3 (chains A)
MADLNWISMRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDI
RQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMI
ITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMN
SVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVK

Sequence of entity 4 (B), FASTA

>5Z2Q_4 Transcriptional enhancer factor TEF-3 (chains B)
MADLDLNWISMRSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETV
DIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPEN
MIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYM
MNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVK

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Structural and functional similarity between the Vgll1-TEAD and the YAP-TEAD complexes. Pobbati, A.V., Chan, S.W., Lee, I. et al. Structure (2012) 20:1135-1140. DOI 10.1016/j.str.2012.04.004 · PubMed

Other PDB entries of the same protein (UniProt Q99NC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SYN 1.3 Å, Crystal structure of TEAD4 in complex with Vgll1-peptide and IAG933

Browse structure collections

About this viewer

MolViewer shows 5Z2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.