5Z8X: Human LRRTM2

Crystal structure of human LRRTM2. Determined by X-ray diffraction at 3.15 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,756
Mol. weight: 161.21 kDa
Ligands: NAG
Released: 10 Oct 2018

Explore 5Z8X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z8X contains 24 α-helices and 92 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	39	1	1
β-strand	44-46	3	1
α-helix	55-58	4
β-strand	65-67	3	1
β-strand	75-76	2	2
β-strand	89-91	3	1
β-strand	99-100	2	2
β-strand	113-115	3	1
β-strand	137-139	3	1
β-strand	161-163	3	1
β-strand	185-187	3	1
β-strand	209-211	3	1
β-strand	219-221	3	3
α-helix	222-225	4
β-strand	233-235	3	1
β-strand	243-245	3	3
β-strand	257-259	3	1
β-strand	267-268	2	3
β-strand	281-283	3	1
α-helix	294-297	4
β-strand	305-307	3	1
β-strand	314	1	4
α-helix	317-319	3
α-helix	320-328	9
β-strand	332	1	1
β-strand	338	1	5
β-strand	341	1	4
β-strand	349	1	5
α-helix	350-356	7

Chain B: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	39-40	2	6
β-strand	44-46	3	6
α-helix	55-58	4
β-strand	65-67	3	6
β-strand	75-76	2	7
β-strand	89-91	3	6
β-strand	99-100	2	7
β-strand	113-115	3	6
β-strand	137-139	3	6
β-strand	161-163	3	6
β-strand	185-187	3	6
β-strand	209-211	3	6
β-strand	219-221	3	8
α-helix	222-225	4
β-strand	233-235	3	6
β-strand	243-245	3	8
β-strand	257-259	3	6
β-strand	267-268	2	8
β-strand	281-283	3	6
α-helix	294-297	4
β-strand	305-307	3	6
β-strand	314	1	9
α-helix	317-319	3
α-helix	320-328	9
β-strand	332-333	2	6
β-strand	338	1	10
β-strand	341	1	9
β-strand	349	1	10
α-helix	350-356	7

Chain C: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	39-40	2	11
β-strand	44-46	3	11
β-strand	65-67	3	11
β-strand	75-76	2	12
β-strand	89-91	3	11
β-strand	99-100	2	12
β-strand	113-115	3	11
β-strand	137-139	3	11
β-strand	161-163	3	11
β-strand	185-187	3	11
β-strand	209-211	3	11
β-strand	219-221	3	13
α-helix	222-225	4
β-strand	233-235	3	11
β-strand	243-245	3	13
β-strand	257-259	3	11
β-strand	267-268	2	13
β-strand	281-283	3	11
α-helix	294-297	4
β-strand	305-307	3	11
β-strand	313-314	2	14
α-helix	317-319	3
α-helix	320-328	9
β-strand	332-333	2	11
β-strand	338	1	15
β-strand	339-341	3	14
α-helix	343-345	3
β-strand	349	1	15
α-helix	350-356	7

Chain D: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	39-40	2	16
β-strand	44-46	3	16
α-helix	55-58	4
β-strand	65-67	3	16
β-strand	75-76	2	17
β-strand	89-91	3	16
β-strand	99-100	2	17
β-strand	113-115	3	16
β-strand	137-139	3	16
β-strand	161-163	3	16
β-strand	185-187	3	16
β-strand	209-211	3	16
β-strand	219-221	3	18
α-helix	222-225	4
β-strand	233-235	3	16
β-strand	243-245	3	18
β-strand	257-259	3	16
β-strand	267-268	2	18
β-strand	281-283	3	16
α-helix	294-297	4
β-strand	305-307	3	16
β-strand	314	1	19
α-helix	317-319	3
α-helix	320-328	9
β-strand	332	1	16
β-strand	338	1	20
β-strand	341	1	19
β-strand	349	1	20
α-helix	350-356	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucine-rich repeat transmembrane neuronal protein 2	A, B, C, D	protein	346	Homo sapiens	O43300 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5Z8X_1 Leucine-rich repeat transmembrane neuronal protein 2 (chains A, B, C, D)
CPPKCRCEKLLFYCDSQGFHSVPNALDKGSLGLSLRHNHITELERDQFASFSQLTWLHLD
HNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELF
YGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLE
HNQLTKINFAHFLRLSSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVF
ETMPNLKILLMDNNKLNSLDSKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRW
EHSILCHSPDHTQGEDILDAVHGFQLCWNLSTTVTVMATTHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

Structural insights into modulation and selectivity of transsynaptic neurexin-LRRTM interaction. Yamagata, A., Goto-Ito, S., Sato, Y. et al. Nat Commun (2018) 9:3964-3964. DOI 10.1038/s41467-018-06333-8 · PubMed

Other PDB entries of the same protein (UniProt O43300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Z8Y 3.4 Å, Crystal structure of human LRRTM2 in complex with Neurexin 1beta

Browse structure collections

About this viewer

MolViewer shows 5Z8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.