5ZOG: R192F hFen1

Crystal Structure of R192F hFen1 in complex with DNA. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 3,359
Mol. weight: 50.8 kDa
Released: 30 Jan 2019

Explore 5ZOG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZOG contains 24 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	15-17	3
β-strand	18-21	4	1
α-helix	23-26	4
β-strand	30-34	5	1
α-helix	35-45	11
β-strand	47-48	2	2
β-strand	51-52	2	2
β-strand	54	1	3
β-strand	60	1	3
α-helix	62-76	15
β-strand	80-85	6	1
α-helix	89-90	2
α-helix	91-99	9
α-helix	129-131	3
α-helix	135-148	14
β-strand	152-154	3	1
α-helix	159-168	10
β-strand	174-176	3	1
α-helix	181-184	4
β-strand	189-192	4	1
α-helix	194-200	7
α-helix	203	1
β-strand	204-208	5	1
α-helix	209-216	8
α-helix	220-230	11
α-helix	243-253	11
α-helix	256-262	7
α-helix	269-271	3
α-helix	276-284	9
α-helix	291-293	3
α-helix	299-301	3
α-helix	303-306	4
α-helix	307-313	7
α-helix	318-339	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Flap endonuclease 1	A	protein	344	Homo sapiens	P39748 (AlphaFold model)
DNA (5'-d(cpcpcpgptpcp*c)-3')	B	DNA	7	synthetic construct
DNA (5'-d(ptpcpcptpcptpgpcpcptpcpapapgpapcpgpgp*g)-3')	C	DNA	19	synthetic construct
DNA (5'-d(tpgpapgpgpcpapgpapgpgpap*t)-3')	D	DNA	13	synthetic construct

Sequence of entity 1 (A), FASTA

>5ZOG_1 Flap endonuclease 1 (chains A)
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMFHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQKLAAALEHHHH

Sequence of entity 2 (B), FASTA

>5ZOG_2 DNA (5'-D(*CP*CP*CP*GP*TP*CP*C)-3') (chains B)
CCCGTCC

Sequence of entity 3 (C), FASTA

>5ZOG_3 DNA (5'-D(P*TP*CP*CP*TP*CP*TP*GP*CP*CP*TP*CP*AP*AP*GP*AP*CP*GP*GP*G)-3') (chains C)
TCCTCTGCCTCAAGACGGG

Sequence of entity 4 (D), FASTA

>5ZOG_4 DNA (5'-D(*TP*GP*AP*GP*GP*CP*AP*GP*AP*GP*GP*AP*T)-3') (chains D)
TGAGGCAGAGGAT

Primary citation

Structural basis of 5' flap recognition and protein-protein interactions of human flap endonuclease 1. Xu, H., Shi, R., Han, W. et al. Nucleic Acids Res (2018) 46:11315-11325. DOI 10.1093/nar/gky911 · PubMed

Other PDB entries of the same protein (UniProt P39748 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RCI 1.66 Å, Crystal Structure of Flap Endonuclease FEN1 with Compound 28
1U7B 1.88 Å, Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)
5ZOD 1.9 Å, Crystal Structure of hFen1 in apo form
5ZOE 1.95 Å, Crystal Structure of D181A hFen1 in complex with DNA
5E0V 2.07 Å, Human PCNA variant (S228I) complexed with FEN1 at 2.1 Angstroms
5K97 2.1 Å, Flap endonuclease 1 (FEN1) D233N with cleaved product fragment and Sm3+
5KSE 2.1 Å, Flap endonuclease 1 (FEN1) R100A with 5'-flap substrate DNA and Sm3+
9RDI 2.1 Å, Crystal Structure of Flap Endonuclease FEN1 with Compound 5
3Q8K 2.2 Å, Crystal Structure of Human Flap Endonuclease FEN1 (WT) in complex with product 5'-flap…
5ZOF 2.25 Å, Crystal Structure of D181A/R192F hFen1 in complex with DNA
3Q8L 2.32 Å, Crystal Structure of Human Flap Endonuclease FEN1 (WT) in complex with substrate 5'-flap…
3UVU 2.38 Å, Structural basis of nuclear import of Flap endonuclease 1 (FEN1)

Browse structure collections

About this viewer

MolViewer shows 5ZOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.