5ZUV: Human Coronavirus 229E HR1 motif

Crystal Structure of the Human Coronavirus 229E HR1 motif in complex with pan-CoVs inhibitor EK1. Determined by X-ray diffraction at 2.21 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 2.21 Å
Organisms: Human coronavirus 229E, synthetic construct
Chains: 3
Atoms: 3,061
Mol. weight: 44.14 kDa
Released: 10 Apr 2019

Explore 5ZUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZUV contains 9 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	788-869	82
α-helix	892-905	14
α-helix	912-915	4

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	789-869	81
α-helix	892-906	15
α-helix	912-915	4

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	787-868	82
α-helix	892-905	14
α-helix	912-915	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spike glycoprotein,Spike glycoprotein,inhibitor EK1	A, B, C	protein	133	Human coronavirus 229E, synthetic construct	P15423 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5ZUV_1 Spike glycoprotein,Spike glycoprotein,inhibitor EK1 (chains A, B, C)
SDVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNS
LNHLTSQLRQNFQAISSSIQAIYDRLDTIQSGGRGGSLDQINVTFLDLEYEMKKLEEAIK
KLEESYIDLKELG

Primary citation

A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Xia, S., Yan, L., Xu, W. et al. Sci Adv (2019) 5:eaav4580-eaav4580. DOI 10.1126/sciadv.aav4580 · PubMed

Other PDB entries of the same protein (UniProt P15423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EJM 1.71 Å, Complex Structure of HLA-A*2402 with the Peptide from HCoV(CoV-229E) spike protein
5YL9 1.86 Å, 1.86 Angstrom crystal structure of human Coronavirus 229E fusion core
7YI6 2.28 Å, bnAb 3D1 in complex with 6-mer HR1 peptide from HCoV-229E S protein
5ZHY 2.44 Å, Structural characterization of the HCoV-229E fusion core
6U7H 3.1 Å, Cryo-EM structure of the HCoV-229E spike glycoprotein
7CYC 3.21 Å, Cryo-EM structures of Alphacoronavirus spike glycoprotein
6ATK 3.5 Å, Crystal structure of the human coronavirus 229E spike protein receptor binding domain in…
7CYD 3.55 Å, Cryo-EM structures of Alphacoronavirus spike glycoprotein
8WDE 3.6 Å, CryoEM structure of the spike protein of human CoV 229E in complex with receptor hAPN…
7VNG 3.8 Å, Crystal structure of human coronavirus 229E spike protein receptor-binding domain in…
7VN9 4.49 Å, Crystal structure of human coronavirus 229E spike protein receptor-binding domain in…

Browse structure collections

About this viewer

MolViewer shows 5ZUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.