5ZYS: Nephrin/MAGI1 complex

Structure of Nephrin/MAGI1 complex. Determined by X-ray diffraction at 1.78 Å resolution. Released 23 Jan 2019.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Mus musculus
Chains: 2
Atoms: 861
Mol. weight: 11.76 kDa
Released: 23 Jan 2019

Explore 5ZYS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ZYS contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	829-837	9	1
α-helix	838	1
β-strand	839	1	2
β-strand	842	1	2
β-strand	845-849	5	1
α-helix	855-856	2
β-strand	857-862	6	1
α-helix	867-871	5
α-helix	878	1
β-strand	879-883	5	1
β-strand	886-887	2	1
α-helix	893-906	14
β-strand	908-916	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1254-1255	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1	A	protein	97	Mus musculus	Q6RHR9 (AlphaFold model)
Nephrin	B	protein	10	Mus musculus

Sequence of entity 1 (A), FASTA

>5ZYS_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A)
GPGSIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELI
CVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVV

Sequence of entity 2 (B), FASTA

>5ZYS_2 Nephrin (chains B)
LPFELRGHLV

Primary citation

Structural Basis of Highly Specific Interaction between Nephrin and MAGI1 in Slit Diaphragm Assembly and Signaling. Weng, Z., Shang, Y., Ji, Z. et al. J Am Soc Nephrol (2018) 29:2362-2371. DOI 10.1681/ASN.2017121275 · PubMed

Other PDB entries of the same protein (UniProt Q6RHR9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I04 2.15 Å, X-ray crystal structure of MAGI-1 PDZ1 bound to the C-terminal peptide of HPV18 E6

Browse structure collections

About this viewer

MolViewer shows 5ZYS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.