6A42: R1EN(5-223)-ubiquitin fusion

R1EN(5-223)-ubiquitin fusion. Determined by X-ray diffraction at 1.7 Å resolution. Released 24 Oct 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Bombyx mori, Bos taurus
Chains: 1
Atoms: 2,515
Mol. weight: 33.18 kDa
Released: 24 Oct 2018

Explore 6A42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A42 contains 11 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
α-helix	22-26	5
α-helix	28-35	8
β-strand	39-43	5	1
β-strand	52-54	3	1
β-strand	61-65	5	1
β-strand	72-74	3	2
α-helix	76-78	3
β-strand	83-88	6	2
β-strand	93-99	7	2
α-helix	107-119	13
β-strand	124-130	7	2
α-helix	136-138	3
α-helix	142-145	4
α-helix	150-165	16
β-strand	169-170	2	2
α-helix	176-178	3
β-strand	180-181	2	3
β-strand	186-187	2	3
β-strand	190-194	5	2
β-strand	200-205	6	1
β-strand	213	1	3
β-strand	216-220	5	1
β-strand	226-231	6	4
β-strand	237-242	6	4
β-strand	247	1	5
α-helix	249-259	11
α-helix	263-265	3
β-strand	266-270	5	4
β-strand	273-274	2	4
α-helix	275-276	2
β-strand	280	1	5
β-strand	291-296	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-directed DNA polymerase homolog (R1),Polyubiquitin-C	A	protein	298	Bombyx mori, Bos taurus	P0CH28 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6A42_1 RNA-directed DNA polymerase homolog (R1),Polyubiquitin-C (chains A)
HMDIRPRLRIGQINLGGAEDATRELPSIARDLGLDIVLVQAQYSMVGFLAQCGAHPKAGV
YIRNRVLPCAVLHHLSSTHITVVHIGGWDLYMVSAYFQYSDPIDPYLHRLGNILDRLRGA
RVVICADTNAHSPLWHSLPRHYVGRGQEVADRRAKMEDFIGARRLVVHNADGHLPTFSTA
NGESYVDVTLSTRGVRVSEWRVTNESSSDHRLIVFGVGGGGSMQIFVKTLTGKTITLEVE
PSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Primary citation

Crystal Structure Determination of Ubiquitin by Fusion to a Protein That Forms a Highly Porous Crystal Lattice. Maita, N. J Am Chem Soc (2018) 140:13546-13549. DOI 10.1021/jacs.8b07512 · PubMed

Other PDB entries of the same protein (UniProt P0CH28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWZ 1.4 Å, TAB2 NZF DOMAIN IN COMPLEX WITH Lys63-linked di-ubiquitin, P212121
2ZCC 1.4 Å, Ubiquitin crystallized under high pressure
3M3J 1.6 Å, A new crystal form of Lys48-linked diubiquitin
4XYZ 1.65 Å, Crystal structure of K33 linked di-Ubiquitin
1P3Q 1.7 Å, Mechanism of Ubiquitin Recognition by the CUE Domain of VPS9
2D3G 1.7 Å, Double sided ubiquitin binding of Hrs-UIM
1WRD 1.75 Å, Crystal structure of Tom1 GAT domain in complex with ubiquitin
1UZX 1.85 Å, A complex of the Vps23 UEV with ubiquitin
2HD5 1.85 Å, USP2 in complex with ubiquitin
2QHO 1.85 Å, Crystal structure of the UBA domain from EDD ubiquitin ligase in complex with ubiquitin
2OOB 1.9 Å, crystal structure of the UBA domain from Cbl-b ubiquitin ligase in complex with ubiquitin
2C7N 2.1 Å, Human Rabex-5 residues 1-74 in complex with Ubiquitin

Browse structure collections

About this viewer

MolViewer shows 6A42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.