6A6H: MHC class I antigen

Crystal Structure of Swine Major Histocompatibility Complex Class I SLA-2*040202 For 2.3 Angstrom. Determined by X-ray diffraction at 2.31 Å resolution. Released 3 Jul 2019.

Method: X-ray diffraction
Resolution: 2.31 Å
Organisms: Sus scrofa, Foot-and-mouth disease virus - type A
Chains: 3
Atoms: 3,227
Mol. weight: 44.01 kDa
Released: 3 Jul 2019

Explore 6A6H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6A6H contains 13 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-52	3
α-helix	57-83	27
β-strand	93-103	11	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-192	7	3
β-strand	199-208	10	3
β-strand	209	1	2
β-strand	213-219	7	4
β-strand	222-223	2	4
α-helix	224	1
β-strand	228-230	3	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
α-helix	254-256	3
β-strand	258-263	6	4
β-strand	270-272	3	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	5
β-strand	8-13	6	6
β-strand	23-32	10	6
β-strand	33	1	5
β-strand	38-43	6	7
β-strand	46-47	2	7
β-strand	51-52	2	6
α-helix	53-55	3
β-strand	56-57	2	6
β-strand	63-71	9	6
β-strand	79-84	6	7
β-strand	92-95	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	275	Sus scrofa	Q8MHU4 (AlphaFold model)
Beta-2-microglobulin	B	protein	98	Sus scrofa	Q07717 (AlphaFold model)
Met-thr-ala-his-ile-val-val-pro-tyr	C	protein	9	Foot-and-mouth disease virus - type A	P49303

Sequence of entity 1 (A), FASTA

>6A6H_1 MHC class I antigen (chains A)
GPHSLRYFDTAVSRPDRGEPRFIEVGYVDDTQFVRFDSDAPNPRMEPRAPWIQQEGQEYW
DRNTRNAMGNAQIYRGNLRTALGYYNQSEAGSHTLQIMYGCDVGPDGLLLRGYSQDAYDG
ADYIALNEDLRSWTAADTAAQITKRKWEAANVAEQWRSYLQGTCVEWLQKYLQMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>6A6H_2 Beta-2-microglobulin (chains B)
VARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWS
FYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>6A6H_3 MET-THR-ALA-HIS-ILE-VAL-VAL-PRO-TYR (chains C)
MTAHIVVPY

Primary citation

Crystallization of SLA-2*04:02:02 complexed with a CTL epitope derived from FMDV. Ning, S., Wang, Z.B., Qi, P. et al. Res Vet Sci (2019) 128:90-98. DOI 10.1016/j.rvsc.2019.11.002 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6A6H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.