6ADB: E148N mutant CLC-ec1 in 20mM bromide
Crystal structure of the E148N mutant CLC-ec1 in 20mM bromide. Determined by X-ray diffraction at 2.69 Å resolution. Released 28 Aug 2019.
- Method
- X-ray diffraction
- Resolution
- 2.69 Å
- Organisms
- Escherichia coli (strain K12), Mus musculus
- Chains
- 6
- Atoms
- 13,247
- Mol. weight
- 195.05 kDa
- Released
- 28 Aug 2019
Explore 6ADB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6ADB contains 77 α-helices and 93 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 26 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-26 | 9 | |
| α-helix | 33-70 | 38 | |
| α-helix | 75-100 | 26 | |
| α-helix | 102-104 | 3 | |
| α-helix | 109-116 | 8 | |
| α-helix | 124-140 | 17 | |
| β-strand | 146 | 1 | 1 |
| α-helix | 148-166 | 19 | |
| α-helix | 171-190 | 20 | |
| α-helix | 193-199 | 7 | |
| α-helix | 200-204 | 5 | |
| α-helix | 215-231 | 17 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-284 | 33 | |
| α-helix | 288-308 | 21 | |
| α-helix | 310-312 | 3 | |
| α-helix | 319-324 | 6 | |
| α-helix | 330-349 | 20 | |
| β-strand | 355 | 1 | 1 |
| α-helix | 357-378 | 22 | |
| α-helix | 380-382 | 3 | |
| α-helix | 386-394 | 9 | |
| α-helix | 396-397 | 2 | |
| α-helix | 398-402 | 5 | |
| α-helix | 405-416 | 12 | |
| α-helix | 419-421 | 3 | |
| α-helix | 422-438 | 17 | |
| α-helix | 444-458 | 15 | |
Chain B: 26 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 18-25 | 8 | |
| α-helix | 33-70 | 38 | |
| α-helix | 75-100 | 26 | |
| α-helix | 102-104 | 3 | |
| α-helix | 109-116 | 8 | |
| α-helix | 124-140 | 17 | |
| β-strand | 146 | 1 | 2 |
| α-helix | 148-165 | 18 | |
| α-helix | 171-190 | 20 | |
| α-helix | 193-199 | 7 | |
| α-helix | 200-204 | 5 | |
| α-helix | 215-231 | 17 | |
| α-helix | 249-251 | 3 | |
| α-helix | 252-284 | 33 | |
| α-helix | 288-308 | 21 | |
| α-helix | 310-312 | 3 | |
| α-helix | 319-324 | 6 | |
| α-helix | 330-349 | 20 | |
| β-strand | 355 | 1 | 2 |
| α-helix | 357-378 | 22 | |
| α-helix | 380-382 | 3 | |
| α-helix | 386-394 | 9 | |
| α-helix | 396-397 | 2 | |
| α-helix | 398-402 | 5 | |
| α-helix | 405-416 | 12 | |
| α-helix | 419-421 | 3 | |
| α-helix | 422-438 | 17 | |
| α-helix | 444-455 | 12 | |
Chain C: 7 helices, 23 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 3 |
| β-strand | 11-12 | 2 | 4 |
| β-strand | 18-25 | 8 | 3 |
| β-strand | 34-39 | 6 | 5 |
| β-strand | 45-51 | 7 | 5 |
| β-strand | 58-60 | 3 | 5 |
| β-strand | 68-73 | 6 | 3 |
| β-strand | 78-83 | 6 | 3 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-100 | 9 | 5 |
| β-strand | 107-111 | 5 | 5 |
| β-strand | 115-117 | 3 | 5 |
| β-strand | 118-119 | 2 | 4 |
| α-helix | 122-124 | 3 | |
| β-strand | 125 | 1 | 6 |
| α-helix | 126-127 | 2 | |
| β-strand | 128-132 | 5 | 7 |
| α-helix | 133-135 | 3 | |
| β-strand | 143-153 | 11 | 7 |
| β-strand | 154 | 1 | 6 |
| β-strand | 159-162 | 4 | 8 |
| α-helix | 163-165 | 3 | |
| β-strand | 167 | 1 | 8 |
| β-strand | 171-173 | 3 | 7 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 7 |
| β-strand | 182-192 | 11 | 7 |
| β-strand | 201-207 | 7 | 8 |
| α-helix | 208-210 | 3 | |
| β-strand | 212-218 | 7 | 8 |
Chain D: 5 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 9 |
| β-strand | 10-13 | 4 | 10 |
| β-strand | 19-25 | 7 | 9 |
| β-strand | 33-37 | 5 | 10 |
| β-strand | 44-48 | 5 | 10 |
| β-strand | 52-53 | 2 | 10 |
| α-helix | 54 | 1 | |
| β-strand | 61-66 | 6 | 9 |
| β-strand | 69-74 | 6 | 9 |
| β-strand | 83-89 | 7 | 10 |
| β-strand | 96-97 | 2 | 10 |
| β-strand | 98 | 1 | 9 |
| β-strand | 102-105 | 4 | 10 |
| β-strand | 110 | 1 | 11 |
| β-strand | 113-117 | 5 | 12 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-125 | 5 | |
| β-strand | 128-136 | 9 | 12 |
| β-strand | 139 | 1 | 11 |
| β-strand | 144-149 | 6 | 13 |
| β-strand | 152-154 | 3 | 13 |
| β-strand | 158-162 | 5 | 12 |
| α-helix | 163-166 | 4 | |
| β-strand | 173-181 | 9 | 12 |
| α-helix | 182-186 | 5 | |
| β-strand | 190-196 | 7 | 13 |
| β-strand | 204-209 | 6 | 13 |
Chain E: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 14 |
| β-strand | 10-12 | 3 | 15 |
| β-strand | 18-25 | 8 | 14 |
| β-strand | 34-39 | 6 | 15 |
| β-strand | 45-51 | 7 | 15 |
| β-strand | 58-60 | 3 | 15 |
| β-strand | 68-73 | 6 | 14 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 14 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 15 |
| β-strand | 106-111 | 6 | 15 |
| β-strand | 115-119 | 5 | 15 |
| β-strand | 125 | 1 | 16 |
| α-helix | 126-127 | 2 | |
| β-strand | 128-132 | 5 | 17 |
| β-strand | 143-153 | 11 | 17 |
| β-strand | 154 | 1 | 16 |
| β-strand | 159-162 | 4 | 18 |
| α-helix | 163-165 | 3 | |
| β-strand | 167 | 1 | 18 |
| β-strand | 171-173 | 3 | 17 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 17 |
| β-strand | 182-192 | 11 | 17 |
| β-strand | 202-207 | 6 | 18 |
| α-helix | 208-210 | 3 | |
| β-strand | 212-217 | 6 | 18 |
Chain F: 7 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 19 |
| β-strand | 10-13 | 4 | 20 |
| β-strand | 15 | 1 | 21 |
| β-strand | 17 | 1 | 21 |
| β-strand | 19-29 | 11 | 19 |
| β-strand | 33-37 | 5 | 20 |
| β-strand | 44-48 | 5 | 20 |
| β-strand | 52-53 | 2 | 20 |
| α-helix | 54 | 1 | |
| β-strand | 61-74 | 14 | 19 |
| α-helix | 79-81 | 3 | |
| β-strand | 84-89 | 6 | 20 |
| β-strand | 96-97 | 2 | 20 |
| β-strand | 101-105 | 5 | 20 |
| β-strand | 110 | 1 | 22 |
| β-strand | 113-117 | 5 | 23 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-124 | 4 | |
| β-strand | 128-138 | 11 | 23 |
| β-strand | 139 | 1 | 22 |
| β-strand | 144-149 | 6 | 24 |
| β-strand | 154 | 1 | 24 |
| β-strand | 158-162 | 5 | 23 |
| α-helix | 163-166 | 4 | |
| β-strand | 172-181 | 10 | 23 |
| α-helix | 182-186 | 5 | |
| β-strand | 190-196 | 7 | 24 |
| α-helix | 203 | 1 | |
| β-strand | 204-209 | 6 | 24 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| H(+)/Cl(-) exchange transporter ClcA | A, B | protein | 473 | Escherichia coli (strain K12) | P37019 (AlphaFold model) |
| antibody Fab fragment, heavy chain | C, E | protein | 222 | Mus musculus | |
| antibody Fab fragment, light chain | D, F | protein | 211 | Mus musculus | |
Sequence of entity 1 (A, B), FASTA
>6ADB_1 H(+)/Cl(-) exchange transporter ClcA (chains A, B)
MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWL
QNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQR
PVRWWRVLPVKFFGGLGTLGGGMVLGRNGPTVQIGGNIGRMVLDIFRLKGDEARHTLLAT
GAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALID
VGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGG
LCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPM
LALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQ
LILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEAEQLARSKAASASENT
Sequence of entity 2 (C, E), FASTA
>6ADB_2 antibody Fab fragment, heavy chain (chains C, E)
EVRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINY
TPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVS
SAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQA
ALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Sequence of entity 3 (D, F), FASTA
>6ADB_3 antibody Fab fragment, light chain (chains D, F)
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVR
FSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Primary citation
Mutation of external glutamate residue reveals a new intermediate transport state and anion binding site in a CLC Cl-/H+antiporter. Park, K., Lee, B.C., Lim, H.H. Proc Natl Acad Sci U S A (2019) 116:17345-17354. DOI 10.1073/pnas.1901822116 · PubMed
Other PDB entries of the same protein (UniProt P37019 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4ENE 2.4 Å, Structure of the N- and C-terminal trimmed ClC-ec1 Cl-/H+ antiporter and Fab Complex
- 1OTS 2.51 Å, Structure of the Escherichia coli ClC Chloride channel and Fab Complex
- 8GA1 2.6 Å, CLC-ec1 R230C/L249C/C85A at pH 4.5 100mM Cl Swap
- 8GA5 2.6 Å, CLC-ec1 L25C/A450C/C85A at pH 4.5 100mM Cl Intermediate
- 6V2J 2.62 Å, Crystal structure of ClC-ec1 triple mutant (E113Q, E148Q, E203Q)
- 3DET 2.8 Å, Structure of the E148A, Y445A doubly ungated mutant of E.coli CLC_Ec1, Cl-/H+ antiporter
- 4KKL 2.85 Å, Structure of the E148A mutant of CLC-ec1 delta NC construct in 100mM fluoride
- 4KK8 2.86 Å, Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride
- 4KJQ 2.88 Å, Structure of the CLC-ec1 deltaNC construct in 100mM fluoride
- 3EJZ 2.9 Å, Structure of E203V mutant E.coli Cl-/H+ exchanger, CLC-ec1
- 7CVT 2.9 Å, Crystal structure of the C85A/L194A/H234C mutant CLC-ec1 with Fab fragment
- 8GAH 2.9 Å, CLC-ec1 L25C/A450C/C85A at pH 4.5 100mM Cl Twist
Browse structure collections
About this viewer
MolViewer shows 6ADB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.