6AE3: GSK3beta

Crystal structure of GSK3beta complexed with Morin. Determined by X-ray diffraction at 2.14 Å resolution. Released 19 Sept 2018.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Mus musculus
Chains: 4
Atoms: 10,953
Mol. weight: 188.36 kDa
Ligands: MRI
Released: 19 Sept 2018

Explore 6AE3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AE3 contains 95 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	37-44	8	1
β-strand	52-64	13	1
β-strand	68-75	8	1
β-strand	81-88	8	1
α-helix	96-102	7
β-strand	109	1	2
β-strand	112-119	8	1
β-strand	126-133	8	1
β-strand	137-138	2	2
α-helix	139-148	10
α-helix	152-154	3
α-helix	155-173	19
β-strand	177-178	2	3
α-helix	184-186	3
β-strand	187-189	3	2
β-strand	196-198	3	2
α-helix	201-203	3
β-strand	205-206	2	3
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	264-273	10
α-helix	275-277	3
α-helix	278-284	7
α-helix	297-300	4
α-helix	301-304	4
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-344	7
α-helix	354-358	5
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-382	3

Chain B: 23 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	38-44	7	4
β-strand	52-64	13	4
β-strand	68-75	8	4
β-strand	81-88	8	4
α-helix	96-102	7
β-strand	109	1	5
β-strand	112-118	7	4
β-strand	127-133	7	4
β-strand	137-138	2	5
α-helix	139-148	10
α-helix	155-173	19
β-strand	177-178	2	6
α-helix	184-186	3
β-strand	187-190	4	5
β-strand	195-198	4	5
α-helix	201-203	3
β-strand	205-206	2	6
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	264-273	10
α-helix	275-277	3
α-helix	278-284	7
α-helix	297-300	4
α-helix	301-304	4
α-helix	311-318	8
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-344	7
α-helix	354-358	5
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-382	3

Chain C: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	38-44	7	7
β-strand	52-64	13	7
β-strand	68-75	8	7
β-strand	81-88	8	7
α-helix	89-90	2
α-helix	96-103	8
β-strand	109	1	8
β-strand	112-117	6	7
β-strand	127-133	7	7
β-strand	138	1	8
α-helix	139-148	10
α-helix	152-154	3
α-helix	155-173	19
β-strand	177-178	2	9
α-helix	184-186	3
β-strand	187-189	3	8
β-strand	196-198	3	8
α-helix	201-203	3
β-strand	205-206	2	9
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	264-273	10
α-helix	276-277	2
α-helix	278-284	7
α-helix	301-304	4
α-helix	311-320	10
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-344	7
α-helix	355-357	3
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-382	3

Chain D: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	38-44	7	10
β-strand	52-64	13	10
β-strand	69-75	7	10
β-strand	81-87	7	10
α-helix	96-102	7
β-strand	109	1	11
β-strand	112-117	6	10
β-strand	128-133	6	10
β-strand	137-138	2	11
α-helix	139-147	9
α-helix	155-174	20
β-strand	177-178	2	12
α-helix	184-186	3
β-strand	187-190	4	11
β-strand	195-198	4	11
α-helix	201-203	3
β-strand	205-206	2	12
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	264-273	10
α-helix	275-277	3
α-helix	278-283	6
α-helix	297-300	4
α-helix	301-304	4
α-helix	306	1
α-helix	311-318	8
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-335	5
α-helix	338-340	3
α-helix	341-344	4
β-strand	349	1	13
β-strand	355	1	13
α-helix	356-357	2
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen synthase kinase-3 beta	A, B, C, D	protein	420	Mus musculus	Q9WV60 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6AE3_1 Glycogen synthase kinase-3 beta (chains A, B, C, D)
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST

Ligands and cofactors

ID	Name	Formula	Copies
MRI	2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one	C15 H10 O7	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of GSK3 beta in complex with the flavonoid, morin. Kim, K., Cha, J.S., Kim, J.S. et al. Biochem Biophys Res Commun (2018) 504:519-524. DOI 10.1016/j.bbrc.2018.08.182 · PubMed

Other PDB entries of the same protein (UniProt Q9WV60 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VME 2.3 Å, Crystal structure of the GSK-3/Axin complex bound to a phosphorylated beta-catenin T41A…
8VMG 2.45 Å, Crystal structure of GSK-3 26-383 bound to Axin 383-435
4NU1 2.5 Å, Crystal structure of a transition state mimic of the GSK-3/Axin complex bound to…
8VMF 2.5 Å, Crystal structure of a transition-state mimic of the GSK-3/Axin complex bound to a…
5AIR 2.53 Å, Structural analysis of mouse GSK3beta fused with LRP6 peptide.

Browse structure collections

About this viewer

MolViewer shows 6AE3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.