6AHO: Kap114p

Crystal structure of Kap114p. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Oct 2019.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 7,294
Mol. weight: 114.43 kDa
Released: 23 Oct 2019

Explore 6AHO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AHO contains 59 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 59 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-8	6
α-helix	16-31	16
α-helix	34-45	12
α-helix	51-68	18
α-helix	84-98	15
α-helix	105-126	22
α-helix	130-140	11
α-helix	144-157	14
α-helix	160-164	5
α-helix	168-180	13
α-helix	187-205	19
α-helix	213-215	3
α-helix	216-233	18
α-helix	243-263	21
α-helix	266-268	3
α-helix	271-289	19
α-helix	304-320	17
α-helix	328-341	14
α-helix	344-345	2
α-helix	346-354	9
α-helix	356-363	8
α-helix	372-380	9
α-helix	385-400	16
α-helix	409-420	12
α-helix	431-447	17
α-helix	453-469	17
α-helix	471-473	3
α-helix	477-494	18
α-helix	498-514	17
α-helix	517-520	4
α-helix	523-541	19
α-helix	546-561	16
α-helix	571-587	17
α-helix	592-605	14
α-helix	611-634	24
α-helix	641-654	14
α-helix	662	1
β-strand	663	1	1
α-helix	664	1
α-helix	665-681	17
α-helix	685-700	16
β-strand	702	1	1
α-helix	704-707	4
α-helix	708-710	3
α-helix	711-722	12
α-helix	728-731	4
α-helix	735-744	10
α-helix	746-749	4
α-helix	750-752	3
α-helix	753-766	14
α-helix	770-786	17
α-helix	788-795	8
β-strand	799-800	2	2
β-strand	803-804	2	2
α-helix	805-817	13
α-helix	823-837	15
α-helix	842-846	5
β-strand	848-854	7	3
β-strand	873-878	6	3
α-helix	879-895	17
α-helix	897-899	3
α-helix	965-979	15
α-helix	981-983	3
α-helix	984-990	7
α-helix	993-1002	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit beta-5	A	protein	1009	Saccharomyces cerevisiae	P53067 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6AHO_1 Importin subunit beta-5 (chains A)
GPLGSMDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQ
FALLSLRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCI
VQISAVDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEI
VFKVLNTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLT
LNFGNVDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANV
ETTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSD
FNTFVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYL
LQCILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALP
DIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIR
IINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVV
VQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLK
KKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIM
KVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQN
LLSVLCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSN
LFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQS
KQPNPEQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDI
TGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL

Primary citation

Karyopherin Kap114p-mediated trans-repression controls ribosomal gene expression under saline stress. Liao, C.C., Shankar, S., Pi, W.C. et al. EMBO Rep (2020) 21. DOI 10.15252/embr.201948324 · PubMed

Other PDB entries of the same protein (UniProt P53067 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9B3I 2.88 Å, Cryo-EM structure of yeast (Nap1)2-H2A-H2B-Kap114-RanGTP
9B31 3.2 Å, Cryo-EM structure of yeast (Nap1)2-Kap114-H2A-H2B
8F0X 3.21 Å, Cryo-EM structure of Kap114 bound to H2A-H2B
8F1E 3.28 Å, Cryo-EM structure of Kap114 bound to Gsp1 (RanGTP) and H2A-H2B
8F19 3.49 Å, Cryo-EM structure of Kap114 bound to Gsp1 (RanGTP)
9B3F 3.54 Å, Cryo-EM structure of yeast (Nap1)2-H2A-H2B-Kap114
8H5B 4.03 Å, The cryo-EM structure of nuclear transport receptor Kap114p complex with yeast TATA-box…

Browse structure collections

About this viewer

MolViewer shows 6AHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.