6AKT: CVA10 A-particle

Name: PDB 6AKT: Cryo-EM structure of CVA10 A-particle
Published: 2019-01-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Cryo-EM structure of CVA10 A-particle. Determined by electron microscopy at 2.8 Å resolution. Released 16 Jan 2019.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Coxsackievirus A10
Chains: 3
Atoms: 5,298
Mol. weight: 87.3 kDa
Released: 16 Jan 2019

Explore 6AKT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6AKT contains 23 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	76-78	3
β-strand	79	1	1
α-helix	80-83	4
β-strand	88-97	10	2
β-strand	105-109	5	3
α-helix	118-122	5
β-strand	125-140	16	2
β-strand	149-155	7	3
α-helix	160-162	3
α-helix	168-171	4
β-strand	177-181	5	3
α-helix	185-186	2
β-strand	187-191	5	2
β-strand	200-201	2	2
β-strand	206	1	4
β-strand	231-236	6	3
α-helix	241-242	2
β-strand	244-262	19	2
α-helix	264-266	3
β-strand	272	1	5
β-strand	275	1	5

Chain B: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	6
β-strand	21-24	4	6
β-strand	32-33	2	7
α-helix	41-44	4
α-helix	46-50	5
α-helix	52-53	2
β-strand	54	1	7
β-strand	64-65	2	7
α-helix	67-68	2
β-strand	69-71	3	7
β-strand	78-82	5	8
α-helix	84-86	3
α-helix	92-96	5
β-strand	102-112	11	7
β-strand	119-128	10	8
α-helix	149-152	4
β-strand	159-160	2	8
α-helix	164-166	3
α-helix	173-178	6
β-strand	181-185	5	8
β-strand	191-196	6	7
β-strand	205	1	7
β-strand	210	1	4
β-strand	213-224	12	8
β-strand	227	1	9
β-strand	229	1	9
β-strand	233-246	14	7

Chain C: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	2
α-helix	31-33	3
β-strand	39	1	2
β-strand	42	1	1
α-helix	44-47	4
β-strand	51-53	3	10
α-helix	64-67	4
β-strand	68-72	5	10
β-strand	80-85	6	11
α-helix	98-103	6
β-strand	106-120	15	10
β-strand	126	1	12
β-strand	128-134	7	11
α-helix	139-141	3
α-helix	144-147	4
β-strand	152-156	5	11
β-strand	162-172	11	10
β-strand	191-196	6	11
β-strand	201	1	12
β-strand	209-218	10	10
β-strand	223-227	5	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
VP1	A	protein	298	Coxsackievirus A10	W0G0K3
VP2	B	protein	255	Coxsackievirus A10	A0A0C5AZ80
VP3	C	protein	240	Coxsackievirus A10	A0A0C5AWF6

Sequence of entity 1 (A), FASTA

>6AKT_1 VP1 (chains A)
GDPVEDIIHDALGSTARRAISSATNVESAANTTPSSHRLETGRVPALQAAETGATSNATD
ENMIETRCVVNRNGVLETTINHFFSRSGLVGVVNLTDGGTDTTGYVTWDIDIMGFVQLRR
KCEMFTYMRFNAEFTFVTTTKNGEARPYMLQYMYVPPGAPKPTGRDAFQWQTATNPSVFV
KLTDPPAQVSVPFMSPASAYQWFYDGYPTFGQHPETSNTTYGLCPNNMMGTFAVRVVSRE
ASQLKLQTRVYMKLKHVRAWVPRPIRSQPYLLKNFPNYDSSKITNSARDRSSIKQANM

Sequence of entity 2 (B), FASTA

>6AKT_2 VP2 (chains B)
SPSVEACGYSDRVAQLTVGNSSITTQEAANIVLAYGEWPEYCPDTDATAVDKPTRPDVSV
NRFYTLDSKMWQENSTGWYWKFPDVLNKTGVFGQNAQFHYLYRSGFCLHVQCNASKFHQG
ALLVAVIPEFVIAGRGSNTKPNEAPHPGFTTTFPGTTGATFHDPYVLDSGVPLSQALIYP
HQWINLRTNNCATVIVPYINAVPFDSAINHSNFGLIVIPVSPLKYSSGATTAIPITITIA
PLNSEFGGLRQAVSQ

Sequence of entity 3 (C), FASTA

>6AKT_3 VP3 (chains C)
GIPAELRPGTNQFLTTDDDTAAPILPGFTPTPTIHIPGEVHSLLELCRVETILEVNNTTE
ATGLTRLLIPVSSQNKADELCAAFMVDPGRIGPWQSTLVGQICRYYTQWSGSLKVTFMFT
GSFMATGKMLVAYSPPGSAQPANRETAMLGTHVIWDFGLQSSVSLVIPWISNTHFRTAKT
GGNYDYYTAGVVTLWYQTNYVVPPETPGEAYIIAMGADLYKFTLKICKDTDEVTQQAVLQ

Primary citation

Structures of Coxsackievirus A10 unveil the molecular mechanisms of receptor binding and viral uncoating. Zhu, L., Sun, Y., Fan, J. et al. Nat Commun (2018) 9:4985-4985. DOI 10.1038/s41467-018-07531-0 · PubMed

Other PDB entries of the same protein (UniProt W0G0K3), best resolution first:

6AKU 2.7 Å, Cryo-EM structure of CVA10 empty particle
6AKS 3.0 Å, Cryo-EM structure of CVA10 mature virus

Browse structure collections

About this viewer

MolViewer shows 6AKT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.