Crystal Structure of Infant Antibody ADI-19425. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Mar 2018.
Explore 6APC in 3D Show helices and sheets RCSB PDB PDBe
6APC contains 16 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 45-51 | 7 | 2 |
| β-strand | 57-59 | 3 | 2 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 2 |
| α-helix | 96-97 | 2 | |
| β-strand | 100E-103 | 4 | 2 |
| β-strand | 107-111 | 5 | 2 |
| β-strand | 117 | 1 | 3 |
| β-strand | 120-127 | 8 | 4 |
| β-strand | 135-145 | 11 | 4 |
| β-strand | 146 | 1 | 3 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 5 |
| β-strand | 163-165 | 3 | 4 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 176-185 | 10 | 4 |
| α-helix | 186-188 | 3 | |
| β-strand | 195-200 | 6 | 5 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 6 |
| β-strand | 5 | 1 | 7 |
| β-strand | 9-13 | 4 | 8 |
| β-strand | 19-24 | 6 | 7 |
| α-helix | 27C-29 | 3 | |
| β-strand | 34-38 | 5 | 8 |
| β-strand | 45-48 | 4 | 8 |
| β-strand | 49 | 1 | 9 |
| β-strand | 53 | 1 | 9 |
| α-helix | 54-55 | 2 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 8 |
| α-helix | 94-95A | 3 | |
| β-strand | 95C-98 | 4 | 8 |
| β-strand | 99 | 1 | 6 |
| β-strand | 102-106 | 5 | 8 |
| β-strand | 112 | 1 | 10 |
| α-helix | 113-114 | 2 | |
| β-strand | 115-119 | 5 | 11 |
| α-helix | 120-122 | 3 | |
| α-helix | 123-127 | 5 | |
| β-strand | 131-140 | 10 | 11 |
| β-strand | 141 | 1 | 10 |
| β-strand | 146-151 | 6 | 12 |
| β-strand | 154-156 | 3 | 12 |
| β-strand | 160-162 | 3 | 11 |
| α-helix | 163-165 | 3 | |
| β-strand | 166-167 | 2 | 11 |
| β-strand | 173-181 | 9 | 11 |
| α-helix | 183-188 | 6 | |
| β-strand | 192-198 | 7 | 12 |
| β-strand | 201-207 | 7 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epididymis luminal protein 214 | H | protein | 226 | Homo sapiens | |
| IGL@ protein | L | protein | 218 | Homo sapiens | Q6GMX4 (AlphaFold model) |
>6APC_1 Epididymis luminal protein 214 (chains H) EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYY ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGYCSGGSCHFDYWGQGTLVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>6APC_2 IGL@ protein (chains L) QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGV PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFYVFGTGTKVTVLGQPKAAPS VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA SSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Infants Infected with Respiratory Syncytial Virus Generate Potent Neutralizing Antibodies that Lack Somatic Hypermutation. Goodwin, E., Gilman, M.S.A., Wrapp, D. et al. Immunity (2018) 48:339-349.e5. DOI 10.1016/j.immuni.2018.01.005 · PubMed
Other PDB entries of the same protein (UniProt Q6GMX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6APC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.