6APC: Infant Antibody ADI-19425

Crystal Structure of Infant Antibody ADI-19425. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Mar 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,935
Mol. weight: 47.03 kDa
Released: 21 Mar 2018

Explore 6APC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6APC contains 16 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-59	3	2
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-95	8	2
α-helix	96-97	2
β-strand	100E-103	4	2
β-strand	107-111	5	2
β-strand	117	1	3
β-strand	120-127	8	4
β-strand	135-145	11	4
β-strand	146	1	3
β-strand	151-154	4	5
α-helix	155-157	3
β-strand	159	1	5
β-strand	163-165	3	4
α-helix	166-168	3
β-strand	169-170	2	4
β-strand	176-185	10	4
α-helix	186-188	3
β-strand	195-200	6	5
α-helix	201-203	3
β-strand	205-210	6	5

Chain L: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	6
β-strand	5	1	7
β-strand	9-13	4	8
β-strand	19-24	6	7
α-helix	27C-29	3
β-strand	34-38	5	8
β-strand	45-48	4	8
β-strand	49	1	9
β-strand	53	1	9
α-helix	54-55	2
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-92	9	8
α-helix	94-95A	3
β-strand	95C-98	4	8
β-strand	99	1	6
β-strand	102-106	5	8
β-strand	112	1	10
α-helix	113-114	2
β-strand	115-119	5	11
α-helix	120-122	3
α-helix	123-127	5
β-strand	131-140	10	11
β-strand	141	1	10
β-strand	146-151	6	12
β-strand	154-156	3	12
β-strand	160-162	3	11
α-helix	163-165	3
β-strand	166-167	2	11
β-strand	173-181	9	11
α-helix	183-188	6
β-strand	192-198	7	12
β-strand	201-207	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epididymis luminal protein 214	H	protein	226	Homo sapiens
IGL@ protein	L	protein	218	Homo sapiens	Q6GMX4 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>6APC_1 Epididymis luminal protein 214 (chains H)
EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGYCSGGSCHFDYWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Sequence of entity 2 (L), FASTA

>6APC_2 IGL@ protein (chains L)
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGV
PDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFYVFGTGTKVTVLGQPKAAPS
VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA
SSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Infants Infected with Respiratory Syncytial Virus Generate Potent Neutralizing Antibodies that Lack Somatic Hypermutation. Goodwin, E., Gilman, M.S.A., Wrapp, D. et al. Immunity (2018) 48:339-349.e5. DOI 10.1016/j.immuni.2018.01.005 · PubMed

Other PDB entries of the same protein (UniProt Q6GMX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W6C 1.63 Å, UCA Fab (unbound) from 6649 Lineage
4D9L 2.48 Å, Fab structure of anti-HIV-1 gp120 V2 mAb 697
5W6G 2.79 Å, Human antibody 6649 in complex with influenza hemagglutinin H1 Solomon Islands
6APD 4.1 Å, Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425

Browse structure collections

About this viewer

MolViewer shows 6APC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.