6ARJ: CARM1 with EPZ022302 and SAH

Crystal structure of CARM1 with EPZ022302 and SAH. Determined by X-ray diffraction at 1.92 Å resolution. Released 7 Feb 2018.

Method

X-ray diffraction

Resolution

1.92 Å

Organism

Homo sapiens

Chains

4

Atoms

12,491

Mol. weight

162.93 kDa

Ligands

BW4, SAH

Released

7 Feb 2018

Explore 6ARJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ARJ contains 64 α-helices and 84 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 21 β-strands

Molecules and chains

>6ARJ_1 Histone-arginine methyltransferase CARM1 (chains A, B, C, D)
SIARSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLD
VGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQ
VDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKA
NFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRI
EIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKA
GDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGT

Ligands and cofactors

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

Identification of a CARM1 Inhibitor with Potent In Vitro and In Vivo Activity in Preclinical Models of Multiple Myeloma. Drew, A.E., Moradei, O., Jacques, S.L. et al. Sci Rep (2017) 7:17993-17993. DOI 10.1038/s41598-017-18446-z · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q86X55 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 8G2H 1.49 Å, Crystal Structure of PRMT4 with Compound YD1113
• 6DVR 1.54 Å, Crystal structure of human CARM1 with (R)-SKI-72
• 8SIG 1.78 Å, Crystal Structure of PRMT4 with Compound YD1-288
• 6S7A 1.86 Å, Crystal structure of CARM1 in complex with inhibitor AA175
• 8UQH 1.87 Å, X-ray crystal structure of PRMT4 bound to compound YD-1130
• 5U4X 1.88 Å, Coactivator-associated arginine methyltransferase 1 with TP-064
• 5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
• 5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
• 5DXJ 1.95 Å, Crystal structure of CARM1 and sinefungin
• 9O6H 1.97 Å, The Structure of PRMT4 in complex with SGC8172
• 4IKP 2.0 Å, Crystal structure of coactivator-associated arginine methyltransferase 1 with…
• 6ARV 2.0 Å, Crystal structure of CARM1 with Compound 2 and SAH

Browse structure collections

About this viewer

MolViewer shows 6ARJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.