Crystal structure of the HopQ-CEACAM3 WT complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 16 May 2018.
Explore 6AVZ in 3D Show helices and sheets RCSB PDB PDBe
6AVZ contains 19 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 9 |
| β-strand | 10-11 | 2 | 10 |
| β-strand | 17-22 | 6 | 9 |
| β-strand | 28-35 | 8 | 11 |
| α-helix | 41-43 | 3 | |
| β-strand | 44-49 | 6 | 11 |
| β-strand | 56-57 | 2 | 11 |
| β-strand | 65-67 | 3 | 9 |
| β-strand | 73-75 | 3 | 9 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-92 | 9 | 11 |
| β-strand | 96 | 1 | 5 |
| β-strand | 97-104 | 8 | 11 |
| β-strand | 105-106 | 2 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 53-72 | 20 | |
| α-helix | 78-97 | 20 | |
| α-helix | 98-100 | 3 | |
| β-strand | 101 | 1 | 1 |
| β-strand | 103 | 1 | 2 |
| β-strand | 106 | 1 | 3 |
| α-helix | 110-112 | 3 | |
| β-strand | 116-121 | 6 | 4 |
| β-strand | 127-132 | 6 | 4 |
| β-strand | 135-136 | 2 | 5 |
| β-strand | 142-143 | 2 | 5 |
| α-helix | 147-149 | 3 | |
| β-strand | 151 | 1 | 3 |
| β-strand | 153 | 1 | 6 |
| β-strand | 157 | 1 | 6 |
| β-strand | 158 | 1 | 2 |
| α-helix | 160-179 | 20 | |
| α-helix | 182-184 | 3 | |
| β-strand | 191-201 | 11 | 4 |
| β-strand | 207-217 | 11 | 4 |
| α-helix | 220-237 | 18 | |
| β-strand | 240 | 1 | 7 |
| β-strand | 241 | 1 | 1 |
| α-helix | 242-243 | 2 | |
| β-strand | 244 | 1 | 8 |
| α-helix | 245 | 1 | |
| α-helix | 257-258 | 2 | |
| β-strand | 263 | 1 | 8 |
| β-strand | 268 | 1 | 7 |
| α-helix | 269-272 | 4 | |
| α-helix | 274-299 | 26 | |
| α-helix | 302-304 | 3 | |
| α-helix | 316-350 | 35 | |
| α-helix | 388-404 | 17 | |
| α-helix | 406-418 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| HopQ | B | protein | 439 | Helicobacter pylori | H6A3H4 (AlphaFold model) |
| Carcinoembryonic antigen-related cell adhesion molecule 3 | A | protein | 109 | Homo sapiens | P40198 (AlphaFold model) |
| part of HopQ loop | E | protein | 3 | Helicobacter pylori P12 |
>6AVZ_1 HopQ (chains B) MGSSHHHHHHSQDPVQKVKNADKVQKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNL NERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKNFHYTDE NGNGTTINCGGSTNSNGTHSSNGTNTLKADKNVSLSIEQYEKIHESYQILSKALKQAGLA PLNSKGEKLEAHVTTSKYQQDSQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPMLIA KSSSGSGGGAATNTPSWQTAGGGKNSCETFGAEFSAASDMINNAQKIVQETQQLSANQPK NITQPHNLNLNTPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCD MSAISSTNMTMQSQKNNWGNGCAGVEETLTSLKTSAADFNNQTPQINQAQNLANTLIQEL GNNPFRNMGMIASSTTNNG
>6AVZ_2 Carcinoembryonic antigen-related cell adhesion molecule 3 (chains A) MAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPG AAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVY
>6AVZ_3 part of HopQ loop (chains E) XXX
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
TheHelicobacter pyloriadhesin protein HopQ exploits the dimer interface of human CEACAMs to facilitate translocation of the oncoprotein CagA. Bonsor, D.A., Zhao, Q., Schmidinger, B. et al. EMBO J (2018) 37. DOI 10.15252/embj.201798664 · PubMed
Other PDB entries of the same protein (UniProt H6A3H4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6AVZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.