Crystal structure of CEACAM3 L44Q. Determined by X-ray diffraction at 2.43 Å resolution. Released 16 May 2018.
Explore 6AW0 in 3D Show helices and sheets RCSB PDB PDBe
6AW0 contains 2 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-11 | 2 | 2 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 28-35 | 8 | 3 |
| β-strand | 39 | 1 | 4 |
| α-helix | 41-43 | 3 | |
| β-strand | 44-49 | 6 | 3 |
| β-strand | 54-57 | 4 | 3 |
| β-strand | 65-67 | 3 | 1 |
| β-strand | 73-75 | 3 | 1 |
| β-strand | 85-92 | 8 | 3 |
| β-strand | 98-103 | 6 | 3 |
| β-strand | 105-106 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Carcinoembryonic antigen-related cell adhesion molecule 3 | A, B | protein | 109 | Homo sapiens | P40198 (AlphaFold model) |
>6AW0_1 Carcinoembryonic antigen-related cell adhesion molecule 3 (chains A, B) MAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSQIVGYVIGTQQATPG AAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVY
TheHelicobacter pyloriadhesin protein HopQ exploits the dimer interface of human CEACAMs to facilitate translocation of the oncoprotein CagA. Bonsor, D.A., Zhao, Q., Schmidinger, B. et al. EMBO J (2018) 37. DOI 10.15252/embj.201798664 · PubMed
Other PDB entries of the same protein (UniProt P40198 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6AW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.