6B57: Tudor

tudor in complex with ligand. Determined by X-ray diffraction at 1.93 Å resolution. Released 1 Nov 2017.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,287
Mol. weight: 51.33 kDa
Released: 1 Nov 2017

Explore 6B57 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B57 contains 24 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	301	1	1
α-helix	302-303	2
β-strand	308-317	10	2
β-strand	320-325	6	2
α-helix	328-345	18
β-strand	359-363	5	3
β-strand	370-378	9	3
α-helix	383	1
β-strand	384-388	5	3
β-strand	394-397	4	3
α-helix	399-401	3
β-strand	403-404	2	3
α-helix	405-406	2
α-helix	407-410	4
α-helix	413	1
β-strand	414	1	4
β-strand	417-421	5	2
β-strand	424-426	3	5
α-helix	433-442	10
α-helix	450	1
β-strand	451-455	5	2
α-helix	467	1
β-strand	468-473	6	2
β-strand	480-481	2	2
α-helix	482-488	7
β-strand	492-494	3	5

Chain B: 13 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	301	1	4
α-helix	302-303	2
β-strand	308-317	10	6
β-strand	320-325	6	6
α-helix	328-345	18
α-helix	347-349	3
β-strand	359-363	5	7
β-strand	370-378	9	7
α-helix	383	1
β-strand	384-388	5	7
β-strand	394-397	4	7
α-helix	399-401	3
β-strand	403-404	2	7
α-helix	405-406	2
α-helix	407-410	4
α-helix	413	1
β-strand	414	1	1
β-strand	417-421	5	6
β-strand	424-426	3	8
α-helix	433-443	11
β-strand	451-455	5	6
α-helix	458-460	3
α-helix	467	1
β-strand	468-475	8	6
β-strand	478-481	4	6
α-helix	482-488	7
β-strand	492-494	3	8
α-helix	512-515	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tudor and KH domain-containing protein	A, B	protein	231	Homo sapiens	Q9Y2W6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6B57_1 Tudor and KH domain-containing protein (chains A, B)
MHHHHHHSSGRENLYFQGEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPE
DLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFL
SLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIY
LYDTSNGKKLDIGLELVHKGYAIELPEGSAGSAGSAGSATGRARARARGRA

Primary citation

Structural basis for arginine methylation-independent recognition of PIWIL1 by TDRD2. Zhang, H., Liu, K., Izumi, N. et al. Proc Natl Acad Sci U S A (2017) 114:12483-12488. DOI 10.1073/pnas.1711486114 · PubMed

Other PDB entries of the same protein (UniProt Q9Y2W6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FDR 1.75 Å, Crystal structure of TDRD2
5J39 1.95 Å, Crystal Structure of the extended TUDOR domain from TDRD2
6PI7 2.8 Å, Crystal structure of the TDRD2 extended Tudor domain in complex with an antibody…
2DIQ Solution structure of the TUDOR domain of Tudor and KH domain containing protein

Browse structure collections

About this viewer

MolViewer shows 6B57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.