Structure of mGluR3 with an agonist. Determined by X-ray diffraction at 2.82 Å resolution. Released 25 Apr 2018.
Explore 6B7H in 3D Show helices and sheets RCSB PDB PDBe
6B7H contains 21 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 33-34 | 2 | 1 |
| β-strand | 39-45 | 7 | 1 |
| β-strand | 48-49 | 2 | 2 |
| β-strand | 59-60 | 2 | 2 |
| α-helix | 62-67 | 6 | |
| α-helix | 68-79 | 12 | |
| β-strand | 91-97 | 7 | 1 |
| α-helix | 102-109 | 8 | |
| α-helix | 110-112 | 3 | |
| β-strand | 142-146 | 5 | 1 |
| α-helix | 151-162 | 12 | |
| β-strand | 168-170 | 3 | 1 |
| α-helix | 176-179 | 4 | |
| β-strand | 187-189 | 3 | 1 |
| α-helix | 194-207 | 14 | |
| β-strand | 212-218 | 7 | 3 |
| α-helix | 223-236 | 14 | |
| β-strand | 240-247 | 8 | 3 |
| α-helix | 254-255 | 2 | |
| α-helix | 256-264 | 9 | |
| β-strand | 271-275 | 5 | 3 |
| α-helix | 278-289 | 12 | |
| β-strand | 296-299 | 4 | 3 |
| α-helix | 307-310 | 4 | |
| α-helix | 314-317 | 4 | |
| β-strand | 321-325 | 5 | 3 |
| α-helix | 331-339 | 9 | |
| α-helix | 351-358 | 8 | |
| β-strand | 362 | 1 | 4 |
| β-strand | 372 | 1 | 4 |
| α-helix | 390-411 | 22 | |
| α-helix | 420-422 | 3 | |
| α-helix | 427-429 | 3 | |
| α-helix | 430-435 | 6 | |
| β-strand | 438-440 | 3 | 5 |
| β-strand | 453-455 | 3 | 5 |
| β-strand | 466-473 | 8 | 3 |
| β-strand | 478-486 | 9 | 3 |
| β-strand | 490-492 | 3 | 3 |
| α-helix | 494-496 | 3 | |
| α-helix | 503-505 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 3 | A | protein | 517 | Homo sapiens | Q14832 (AlphaFold model) |
>6B7H_1 Metabotropic glutamate receptor 3 (chains A) MALKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECG RINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLT KVDEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKL SDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRN ISIATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWV ASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQK FQCSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKL CDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKY SYLKVGHWAETLSLDVNSIHWSRNSVPTSEGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| CWY | (1S,2S,4S,5R,6S)-2-amino-4-[(3-methoxybenzene-1-carbonyl)amino]bicyclo[3.1.0]he… | C16 H18 N2 O6 | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Synthesis and Pharmacological Characterization of C4beta-Amide-Substituted 2-Aminobicyclo[3.1.0]hexane-2,6-dicarboxylates. Identification of (1 S,2 S,4 S,5 R,6 S)-2-Amino-4-[(3-methoxybenzoyl)amino]bicyclo[3.1.0]hexane-2,6-dicarboxylic Acid (LY2794193), a Highly Potent and Selective mGlu3Receptor…. Monn, J.A., Henry, S.S., Massey, S.M. et al. J Med Chem (2018) 61:2303-2328. DOI 10.1021/acs.jmedchem.7b01481 · PubMed
Other PDB entries of the same protein (UniProt Q14832 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6B7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.