6B9M: UHRF1 TTD domain

Crystal structure of UHRF1 TTD domain in complex with the polybasic region. Determined by X-ray diffraction at 1.68 Å resolution. Released 14 Feb 2018.

Method: X-ray diffraction
Resolution: 1.68 Å
Organisms: Danio rerio, Homo sapiens
Chains: 4
Atoms: 4,312
Mol. weight: 57.68 kDa
Released: 14 Feb 2018

Explore 6B9M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6B9M contains 22 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	130	1	1
β-strand	139	1	1
β-strand	142-146	5	2
β-strand	152	1	3
β-strand	153-164	12	2
α-helix	172	1
β-strand	173-180	8	2
β-strand	183	1	2
α-helix	184-186	3
β-strand	189-191	3	2
α-helix	193-195	3
β-strand	196-198	3	2
α-helix	199-200	2
β-strand	203	1	3
α-helix	204-205	2
α-helix	206-208	3
β-strand	214-219	6	3
β-strand	229-240	12	3
β-strand	244	1	4
β-strand	245-251	7	3
α-helix	258-259	2
β-strand	260-265	6	3
α-helix	271	1
β-strand	272	1	3
α-helix	273-275	3

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	130	1	5
β-strand	139	1	5
β-strand	142-146	5	6
β-strand	153-164	12	6
β-strand	173-180	8	6
α-helix	184-186	3
β-strand	188-191	4	6
α-helix	193-195	3
β-strand	196-198	3	6
α-helix	199-200	2
β-strand	203	1	7
α-helix	204-205	2
α-helix	206-208	3
β-strand	214-219	6	7
β-strand	229-241	13	7
β-strand	244-252	9	7
β-strand	260-265	6	7
β-strand	272	1	7
α-helix	273-275	3

Chain C: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	142-146	5	4
β-strand	153-163	11	4
β-strand	174-180	7	4
α-helix	184-186	3
β-strand	188-192	5	4
α-helix	193-195	3
β-strand	196-198	3	4
α-helix	199-200	2
β-strand	203	1	4
α-helix	204-205	2
α-helix	206-208	3
β-strand	214-219	6	4
β-strand	229-240	12	4
β-strand	245-252	8	4
β-strand	259-265	7	4
α-helix	271	1
β-strand	272	1	4
α-helix	273-277	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A, B, C	protein	153	Danio rerio	E7EZF3 (AlphaFold model)
E3 ubiquitin-protein ligase UHRF1	D	protein	41	Homo sapiens	Q96T88 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6B9M_1 E3 ubiquitin-protein ligase UHRF1 (chains A, B, C)
SLIDPGFGFYKINEFVDARDLNMGAWFEAQIVKVTKTPAEDGGPEEIVYHVKYEDYPENG
VVQLRGKDVRPRARTVYQWRQLEPGMIVMVNYNPDDPKERGYWYDAEIQRKRETRTQREV
FGKILLGDAGDSLNDCRIMFVTEIYKIEEPGSA

Sequence of entity 2 (D), FASTA

>6B9M_2 E3 ubiquitin-protein ligase UHRF1 (chains D)
ASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTA

Primary citation

An Intramolecular Interaction of UHRF1 Reveals Dual Control for Its Histone Association. Gao, L., Tan, X.F., Zhang, S. et al. Structure (2018) 26:304-311.e3. DOI 10.1016/j.str.2017.12.016 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6B9M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.