LilrB2 D1D2 domains complexed with benzamidine. Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Sept 2018.
Explore 6BCS in 3D Show helices and sheets RCSB PDB PDBe
6BCS contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 15-17 | 3 | 2 |
| β-strand | 22-27 | 6 | 1 |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 47-49 | 3 | 3 |
| α-helix | 50-51 | 2 | |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 1 |
| β-strand | 59-62 | 4 | 1 |
| α-helix | 67-69 | 3 | |
| β-strand | 71-79 | 9 | 3 |
| β-strand | 82-84 | 2 | 3 |
| α-helix | 85-88 | 4 | |
| α-helix | 90 | 1 | |
| β-strand | 91-93 | 3 | 3 |
| β-strand | 94-96 | 3 | 2 |
| α-helix | 100-102 | 3 | |
| β-strand | 103-107 | 5 | 4 |
| β-strand | 111 | 1 | 5 |
| β-strand | 118-128 | 11 | 4 |
| β-strand | 130-136 | 7 | 6 |
| β-strand | 143-146 | 4 | 6 |
| α-helix | 147-149 | 3 | |
| β-strand | 154-161 | 8 | 4 |
| β-strand | 170-178 | 9 | 6 |
| β-strand | 181-185 | 5 | 6 |
| α-helix | 186-191 | 6 | |
| β-strand | 192-194 | 3 | 6 |
| β-strand | 195 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leukocyte immunoglobulin-like receptor subfamily B member 2 | A | protein | 198 | Homo sapiens | Q8N423 (AlphaFold model) |
>6BCS_1 Leukocyte immunoglobulin-like receptor subfamily B member 2 (chains A) MGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQ FHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTL QCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLN SPYVWSSPSDLLELLVPG
| ID | Name | Formula | Copies |
|---|---|---|---|
| BEN | Benzamidine | C7 H8 N2 | 4 |
Water and common crystallization additives (DMS, CL) are not listed.
Inhibiting amyloid-beta cytotoxicity through its interaction with the cell surface receptor LilrB2 by structure-based design. Cao, Q., Shin, W.S., Chan, H. et al. Nat Chem (2018) 10:1213-1221. DOI 10.1038/s41557-018-0147-z · PubMed
Other PDB entries of the same protein (UniProt Q8N423 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.