Crystal structure of pseduokinase PEAK1 (Sugen Kinase 269). Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Dec 2017.
Explore 6BHC in 3D Show helices and sheets RCSB PDB PDBe
6BHC contains 23 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1286-1309 | 24 | |
| α-helix | 1315-1317 | 3 | |
| α-helix | 1323-1326 | 4 | |
| β-strand | 1327-1329 | 3 | 1 |
| β-strand | 1336-1337 | 2 | 1 |
| β-strand | 1341-1348 | 8 | 1 |
| β-strand | 1351-1361 | 11 | 1 |
| α-helix | 1374-1379 | 6 | |
| α-helix | 1382-1383 | 2 | |
| β-strand | 1387 | 1 | 2 |
| β-strand | 1393-1398 | 6 | 1 |
| α-helix | 1400-1402 | 3 | |
| β-strand | 1456-1463 | 8 | 1 |
| β-strand | 1469-1470 | 2 | 2 |
| α-helix | 1471-1476 | 6 | |
| α-helix | 1479-1484 | 6 | |
| α-helix | 1486-1507 | 22 | |
| α-helix | 1508-1510 | 3 | |
| β-strand | 1512-1513 | 2 | 3 |
| α-helix | 1519-1521 | 3 | |
| β-strand | 1522-1525 | 4 | 2 |
| β-strand | 1550-1553 | 4 | 2 |
| β-strand | 1560-1561 | 2 | 3 |
| α-helix | 1574-1576 | 3 | |
| α-helix | 1579-1583 | 5 | |
| α-helix | 1590-1602 | 13 | |
| α-helix | 1608-1611 | 4 | |
| α-helix | 1626-1629 | 4 | |
| α-helix | 1635-1645 | 11 | |
| α-helix | 1654-1655 | 2 | |
| α-helix | 1656-1667 | 12 | |
| α-helix | 1672-1680 | 9 | |
| α-helix | 1684-1709 | 26 | |
| α-helix | 1719-1730 | 12 | |
| α-helix | 1733-1743 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pseudopodium-enriched atypical kinase 1 | A | protein | 438 | Homo sapiens | Q9H792 (AlphaFold model) |
>6BHC_1 Pseudopodium-enriched atypical kinase 1 (chains A) MQRQALYRGLENREEVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFGVDSWSDFRLT SDKPCCEAGDAVYYTASYAKDPLNNYAVKICKSKAKESQQYYHSLAVRQSLAVHFNIQQD CGHFLAEVPNRLLPWEDPSKKQRSHVVVITREVPCLTVADFVRDSLAQHGKSPDLYERQV CLLLLQLCSGLEHLKPYHVTHCDLRLENLLLVHYQPGGTAQGFGPAEPTPTSSYPTRLIV SNFSQAKQKSHLVDPEILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENP ELKEREYTRADLPRIPFRSPYSRGLQQLASCLLNPNPSERILISDAKGILQCLLWGPRED LFQTFTACPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQYLAFATT DSLSCIVKILLEHHHHHH
The crystal structure of pseudokinase PEAK1 (Sugen kinase 269) reveals an unusual catalytic cleft and a novel mode of kinase fold dimerization. Ha, B.H., Boggon, T.J. J Biol Chem (2018) 293:1642-1650. DOI 10.1074/jbc.RA117.000751 · PubMed
Other PDB entries of the same protein (UniProt Q9H792 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6BHC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.