6BL7: S. cerevisiae stu2 coiled coil domain

S. cerevisiae stu2 coiled coil domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 13 Dec 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,717
Mol. weight: 27.58 kDa
Released: 13 Dec 2017

Explore 6BL7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BL7 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	658-754	97

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	659-753	95

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein STU2	A, B	protein	110	Saccharomyces cerevisiae	P46675 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6BL7_1 Protein STU2 (chains A, B)
GSHMDKNEKLIEEYKYRLQKLQNDEMIWTKERQSLLEKMNNTENYKIEMIKENEMLREQL
KEAQSKLNEKNIQLRSKEIDVNKLSDRVLSLENELRNMEIELDRNKKRND

Primary citation

Stu2 uses a 15-nm parallel coiled coil for kinetochore localization and concomitant regulation of the mitotic spindle. Haase, K.P., Fox, J.C., Byrnes, A.E. et al. Mol Biol Cell (2018) 29:285-294. DOI 10.1091/mbc.E17-01-0057 · PubMed

Other PDB entries of the same protein (UniProt P46675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QK1 1.7 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
7KDF 2.72 Å, Structure of Stu2 Bound to dwarf Ndc80c
4U3J 2.81 Å, TOG2:alpha/beta-tubulin complex
4FFB 2.88 Å, A TOG:alpha/beta-tubulin Complex Structure Reveals Conformation-Based Mechanisms For a…

Browse structure collections

About this viewer

MolViewer shows 6BL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.