6BNT: AP-2 complex subunit mu

Name: PDB 6BNT: Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide
Published: 2018-11-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: endocytosis

Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide. Determined by X-ray diffraction at 3.2 Å resolution. Released 21 Nov 2018.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,084
Mol. weight: 37.36 kDa
Released: 21 Nov 2018

Explore 6BNT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BNT contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	245-248	4	1
β-strand	252-253	2	2
β-strand	263-265	3	2
α-helix	267-268	2
β-strand	270-279	10	1
β-strand	287-296	10	3
β-strand	300-309	10	3
β-strand	316-325	10	1
β-strand	330-337	8	3
β-strand	341-345	5	1
β-strand	350-359	10	1
β-strand	362-372	11	3
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	613-614	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu	A	protein	315	Homo sapiens	Q96CW1 (AlphaFold model)
Insulin receptor substrate 1	B	protein	15	Homo sapiens	P35568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6BNT_1 AP-2 complex subunit mu (chains A)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFGRPGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC

Sequence of entity 2 (B), FASTA

>6BNT_2 Insulin receptor substrate 1 (chains B)
CHTDDGYMPMSPGVA

Primary citation

Mitotic regulators and the SHP2-MAPK pathway promote IR endocytosis and feedback regulation of insulin signaling. Choi, E., Kikuchi, S., Gao, H. et al. Nat Commun (2019) 10:1473-1473. DOI 10.1038/s41467-019-09318-3 · PubMed

Other PDB entries of the same protein (UniProt Q96CW1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6URI 3.0 Å, HIV-1 Nef in complex with the CD4 cytoplasmic domain and the AP2 clathrin adaptor complex
1H6E 3.6 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with ctla-4…
9A0E Structural basis of CD4 downregulation by HIV-1 Nef

Browse structure collections

About this viewer

MolViewer shows 6BNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.