6BW1: Hendra virus W protein C-terminus

Hendra virus W protein C-terminus in complex with Importin alpha 1. Determined by X-ray diffraction at 2.2 Å resolution. Released 4 Jul 2018.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Hendra virus, Mus musculus
Chains: 2
Atoms: 3,431
Mol. weight: 59.98 kDa
Released: 4 Jul 2018

Explore 6BW1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BW1 contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	78-85	8
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-191	16
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-279	15
α-helix	283-291	9
α-helix	295-302	8
α-helix	307-321	15
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-476	8
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein W	C	protein	41	Hendra virus	P0C1C6 (AlphaFold model)
Importin subunit alpha-1	E	protein	510	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>6BW1_1 Protein W (chains C)
SRSLNMLGRKTCLGRRVVQPGMFADYPPTKKARVLLRRMSN

Sequence of entity 2 (E), FASTA

>6BW1_2 Importin subunit alpha-1 (chains E)
MHHHHHHSSGLVPRGSGMLETAAALFERNHMDSPDLGTDDDDLAMADIGSNQGTVNWSVE
DIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFE
SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDL
VIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRL
LHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGN
IVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV
PFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQV
ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVE
EEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Primary citation

Structural basis for importin alpha 3 specificity of W proteins in Hendra and Nipah viruses. Smith, K.M., Tsimbalyuk, S., Edwards, M.R. et al. Nat Commun (2018) 9:3703-3703. DOI 10.1038/s41467-018-05928-5 · PubMed

Other PDB entries of the same protein (UniProt P0C1C6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3

Browse structure collections

About this viewer

MolViewer shows 6BW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.